database logo

IMGT/DomainGapAlign documentation

Citing IMGT/DomainGapAlign:
Ehrenmann F., Kaas Q. and Lefranc M.-P. Nucleic Acids Res., 38, D301-307 (2010). PMID: 19900967 Abstract Full pdf
Ehrenmann, F., Lefranc, M.-P. Cold Spring Harbor Protoc., 6, 737-749 (2011). PMID: 21632775 Abstract also in IMGT booklet with generous provision from Cold Spring Harbor (CSH) Protocols pdf (high res) pdf (low res)

Introduction

IMGT/DomainGapAlign Query page

IMGT/DomainGapAlign and IMGT/Collier-de-Perles results for V-domain

IMGT/DomainGapAlign and IMGT/Collier-de-Perles results for C-domain

>SEQ_C_DOM TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLRSPVTKSFNRGEC

IMGT/DomainGapAlign and IMGT/Collier-de-Perles results for G-domain

>pMH75 FRPWFLEYCKSECHFYNTTQRVRLLVRYFYNLELNLRFDSDVGEFRAVTELGQPDAENWNSQPEFLEQKRAEVDTVCRHNYEIFDNFLVPRR

IMGT/DomainGapAlign and IMGT/Collier-de-Perles results for S-domain

>SEQ_S_DOM PAVESRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQD

References

[1] Lefranc, M.-P. , Giudicelli, V., Ginestoux, C., Bosc, N., Folch, G., Guiraudou, D., Jabado-Michaloud, J., Magris, S., Scaviner, D., Thouvenin, V., Combres, K., Girod, D., Jeanjean, S., Protat, C., Yousfi-Monod, M., Duprat, E., Kaas, Q., Pommie, C., Chaume, D. and Lefranc G. (2004) IMGT-ONTOLOGY for immunogenetics and immunoinformatics. In Silico Biology 4:17-29
[2] Lefranc, M.-P., WHO-IUIS Nomenclature Subcommittee for Immunoglobulins and T cell receptors report, Dev. Comp. Immunol. (in press).
[3] Lefranc, M.-P., Pommié, C., Ruiz, M., Giudicelli, V., Foulquier, E., Truong, L., Thouvenin-Contet, V. and Lefranc G. (2003) IMGT unique numbering for immunoglobulin and T cell receptor variable domains and Ig superfamily V-like domains. Dev Comp Immunol 27:55-77 PMID:12477501
[4] Lefranc, M.-P., Pommié, C., Kaas, Q., Duprat, E., Bosc, N., Guiraudou, D., Jean, C., Ruiz, M., Da Piedade, L., Rouard, M., Foulquier, E., Thouvenin, V. and Lefranc G. (2005) IMGT unique numbering for immunoglobulin and T cell receptor constant domains and Ig superfamily C-like domains. Dev Comp Immunol 29:185-203 PMID:15572068

Version

4.9.2 (2016-09-26)
  • Handle A and F domains
4.9.1 (2013-12-19)
  • Update linking to IMGT/GENE-DB
  • Javascript fixes (species selection)
  • Internal changes
4.9.0 (2013-04-06)
  • Handle both mixed-case (upper/lower) input sequence
  • For V-DOMAIN, show V and J reference allele alignment separetely
  • More internal changes
Created:
10/12/06
IMGT/DomainGapAlign development:
IMGT/DomainGapAlign was implemented by Quentin Kaas (2005) and has been developed since 2006 by François Ehrenmann, and since 2011 by Patrice Duroux
Contact: Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr
Editors: Quentin Kaas (2001-2007), François Ehrenmann (2006-2011), Caroline Tournier (2011-2013), Typhaine Paysan-Lafosse (2013-2016) and Patrice Duroux (LIGM, Montpellier, France)