Proteins with known 3D structures
Protein Display: Human Immunoglobulin V-DOMAINs
Overview table Identification of the genes and alleles involved in the rearrangements and expressed in the variable regions Protein display of the Ig V-D-J and V-J REGIONs

Click here to see: Part 1 - Human IGH V-DOMAINs (V-D-J-REGIONs)
Click here to see: Part 2 - Human IGK V-DOMAINs (V-J-REGIONs)

Part 3 - Human IGL V-DOMAINs (V-J-REGIONs)
Reference of this table: Ruiz, M. and Lefranc, M.-P., Immunogenetics, 53, 857-883 (2002) PMID:11862387, LIGM:259

Updates from 09/05/2001 are available in IMGT/3Dstructure-DB. IMGT/3Dstructure-DB entries (cards) are identified by the PDB code.
Click on a PDB code to get the corresponding IMGT/3Dstructure-DB card.
Click on an asterisk (*) to see the Protein Display of the partner heavy chain.

These sequences were automatically extracted from the the PDB file ATOM records, and correspond to the atomic coordinates present in the PDB file. It is important to note that there may be conflicts between sequence data from the ATOM records and those from the SEQRES records.
Numbering is according to the IMGT unique numbering for V-DOMAIN and V-LIKE-DOMAIN.
_____________________

Protein
 name	   
_____________________
	
	
________

PDB code
	
________  
	  
  _____________________________________________________________________________________________________________________________________

           FR1-IMGT           CDR1-IMGT       FR2-IMGT      CDR2-IMGT               FR3-IMGT                    CDR3-IMGT     FR4-IMGT
            (1-26)             (27-38)        (39-55)        (56-65)                (66-104)
  __________________________ ____________ _________________ __________ _______________________________________ _____________ __________
  1       10        20         30         40        50         60         70        80        90       100        110        120
  .........|.........|...... ...|........ .|.........|..... ....|..... ....|.........|.........|.........|.... .....|....... ..|.......


B7-15A2 

Cle 


Hil 


Jto 


Kol 


Loc 






Loi 


M3C65 

Mcg 


Mcg 


Mcg 





























Mcg 





Newm 

Rf-An 

Rhe 

Wil 

1AQK_L * 

1LIL_A 
1LIL_B

8FAB_A * 
8FAB_C

1CD0_A 
1CD0_B

2FB4_L * 
2IG2_L

1BJM_A 
1BJM_B
3BJL_A
3BJL_B
4BJL_A
4BJL_B

2LOI_A 
2LOI_B

1DL7_L * 

1A8J_H 
1A8J_L

1DCL_A 
1DCL_B

1MCB_A 
1MCB_B
1MCC_A
1MCC_B
1MCD_A
1MCD_B
1MCE_A
1MCE_B
1MCF_A
1MCF_B
1MCH_A
1MCH_B
1MCI_A
1MCI_B
1MCJ_A
1MCJ_B
1MCK_A
1MCK_B
1MCL_A
1MCL_B
1MCN_A
1MCN_B
1MCO_L
1MCQ_A
1MCQ_B
1MCR_A
1MCR_B
1MCS_A
1MCS_B

2MCG_1 
2MCG_2
3MCG_1
3MCG_2
1MCW_M

7FAB_L * 

1ADQ_L * 

2RHE_ 

2CD0_A 
2CD0_B
  -NVLTQPPS-VSGAPGQRVTISCTGS NSNIGAGFT--- VHWYQHLPGTAPKLLIF ANT------- NRPSGVP-DRFSGSK--SGTSASLAITGLQAEDEADYYC QSYDS...SLSAR FGGGTRLTVL

  -YEVTQPPS-LSVSPGQTARITCSGE KLGDAY------ VCWYQQRPGQSPVVVIY QDN------- RRPSGIP-ERFSGSS--SGNTATLTISGTQTLDEADYYC QVWDS...NASVV FGGGTKLTVL


  --ELTQPPS-VSVSPGQTARITCSAN ALPNQY------ AYWYQQKPGRAPVMVIY KDT------- QRPSGIP-QRFSSST--SGTTVTLTISGVQAEDEADYYC QAWDN....SASI FGGGTKLTVL


  NFMLNQPHS-VSESPGKTVTISCTRS SGNIDSNY---- VQWYQQRPGSAPITVIY EDN------- QRPSGVP-DRFAGSIDRSSNSASLTISGLKTEDEADYYC QSYDA....RNVV FGGGTRLTVL


  QSVLTQPPS-ASGTPGQRVTISCSGT SSNIGSST---- VNWYQQLPGMAPKLLIY RDA------- MRPSGVP-DRFSGSK--SGASASLAIGGLQSEDETDYYC AAWDVS..LNAYV FGTGTKVTVL


  XSVLTQPPS-ASGTPGQRVTISCSGS SSNIGENS---- VTWYQHLSGTAPKLLIY EDN------- SRASGVS-DRFSASK--SGTSASLAISGLQPEDETDYYC AAWDDS..LDVAV FGTGTKVTVL






  -YVLTQPPS-VSVAPGETARITCGGN DIGSES------ VHWYQQKPGQAPVLVIY FDR------- DRPSGIP-ERFSGSN--SGNTATLTISRVEAGDEADYYC QLWDSS..SEHVV FGGGTKLTVL


  QAVVTQESA-LTTSPGETVTLTCRSS TGAVTTSNY--- ANWVQEKPDHLFTGLIG GTK------- HRTPGAP-ARFSGSL--IGDKAALTITGAQTEDEAIYFC ALWYS....NHWV FGGGTKLTVL

  -SALTQPPS-ASGSLGQSVTISCTGT SSDVGGYNY--- VSWYQQHAGKAPKVIIY EVN------- KRPSGVP-DRFSGSK--SGNTASLTVSGLQAEDEADYYC SSYEG...SDNFV FGTGTKVTVL


  PSALTQPPS-ASGSLGQSVTISCTGT SSNVGGYNY--- VSWYQQHAGKAPKVIIY EVN------- KRPSGVP-DRFSGSK--SGNTASLTVSGLQAEDEADYYC SSYEG...SDNFV FGTGTKVTVL


  PSALTQPPS-ASGSLGQSVTISCTGT SSDVGGYNY--- VSWYQQHAGKAPKVIIY EVN------- KRPSGVP-DRFSGSK--SGNTASLTVSGLQAEDEADYYC SSYEG...SDNFV FGTGTKVTVL





























  XSALTQPPS-ASGSLGQSVTISCTGT SSDVGGYNY--- VSWYQQHAGKAPKVIIY EVN------- KRPSGVP-DRFSGSK--SGNTASLTVSGLQAEDEADYYC SSYEG...SDNFV FGTGTKVTVL





  ASVLTQPPS-VSGAPGQRVTISCTGS SSNIGAGHN--- VKWYQQLPGTAPKLLIF HNNA------ ---------RFSVSK--SGTSATLAITGLQAEDEADYYC QSYDR....SLRV FGGGTKLTVL

  -YVLTQPPS-VSVAPGQTARITCGGN NIGSKS------ VHWYQQKPGQAPVLVVY DDS------- DRPPGIP-ERFSGSN--SGNTATLTISRVEAGDEADYYC QVWDSS..SDHAV FGGGTKLTVL

  ESVLTQPPS-ASGTPGQRVTISCTGS ATDIGSNS---- VIWYQQVPGKAPKLLIY YND------- LLPSGVS-DRFSASK--SGTSASLAISGLESEDEADYYC AAWNDS..LDEPG FGGGTKLTVL

  NFLLTQPHS-VSESPGKTVTISCTRS SGSIANNY---- VHWYQQRPGSSPTTVIF EDD------- HRPSGVP-DRFSGSVDTSSNSASLTISGLKTEDEADYYC QSYDH....NNQV FGGGTKLTVL


CDR-IMGT regions are colored as follows:
IGL V-J REGION: CDR1-IMGT (blue), CDR2-IMGT (green), CDR3-IMGT (greenblue)


Created: 11/06/2001
Last updated: Wednesday, 29-Jun-2011 17:05:50 CEST
Author: Manuel Ruiz

Software material and data coming from IMGT server may be used for academic research only, provided that it is referred to IMGT®, and cited as "IMGT®, the international ImMunoGeneTics information system® http://www.imgt.org (founder and director: Marie-Paule Lefranc, Montpellier, France)." References to cite: Lefranc, M.-P. et al., Nucleic Acids Res., 27:209-212 (1999); doi: 10.1093/nar/27.1.209 Full text Cover; Ruiz, M. et al., Nucleic Acids Res., 28:219-221 (2000); doi: 10.1093/nar/28.1.219 Full text; Lefranc, M.-P., Nucleic Acids Res., 29:207-209 (2001); doi: 10.1093/nar/29.1.207 Full text; Lefranc, M.-P., Nucleic Acids Res., 31:307-310 (2003); doi: 10.1093/nar/gkg085 Full text; Lefranc, M.-P. et al., In Silico Biol., 5, 0006 (2004) [Epub], 5:45-60 (2005); Lefranc, M.-P. et al., Nucleic Acids Res., 33:D593-597 (2005); doi: 10.1093/nar/gki065 Full text; Lefranc, M.-P. et al., Nucleic Acids Res., 37:D1006-1012 (2009); doi: 10.1093/nar/gkn838 Full text; Lefranc, M.-P. et al., Nucleic Acids Res., 43:D413-422 (2015); doi: 10.1093/nar/gku1056 Full text.
For any other use please contact Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr.

CNRS Université de Montpellier European Commission
IMGT® Founder and Executive Director Emeritus:
Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr
IMGT® Director:
Sofia Kossida Sofia.Kossida@igh.cnrs.fr
Bioinformatics manager:
Véronique Giudicelli Veronique.Giudicelli@igh.cnrs.fr
Computer manager:
Patrice Duroux Patrice.Duroux@igh.cnrs.fr
Webmaster:
Amélie Houles

Citing IMGT | Warranty disclaimer and copyright notice | Privacy policy and advertisement policy

© Copyright 1995-2017 IMGT®, the international ImMunoGeneTics information system®