Protein display: Little skate (Leucoraja erinacea) IGH C-REGIONs

The IGHC protein display numbering is according to the IMGT unique numbering for C-DOMAIN and C-LIKE-DOMAIN.

Only the *01 allele of each functional, ORF and in-frame pseudogenes C-REGION is shown.

N (Asn, asparagine) of potential N-glycosylation sites (NXS/T, where X is different from P), (N-linked glycosylation) is shown is green (site is underlined in CHS and in pages edited before 14/10/2009).

_____________________________________________________________________________________________________________________________________________________________________________________________

      IGHC
      genes
_____________________________________________________________________________________________________________________________________________________________________________________________

                                A                 B         BC         C               D                     E              F               G

                         --------------->    ---------->             ----->        ----------->       -------------->  ------------->   ---------->

                          1       10   15  16  20 23      30    36 39 41 45      77     84             85  89     96 97    104   110 114   120       130       140       150

                   7654321|........|....|123|...|...... ...|.....|  |.....|1234567|......|12345677654321|..........|12|............|...|.....|.........|.........|.........|

  CH1
  M29679  ,IGHM1 c  (A)APSAPSPFILFTCEDQGS...SGSFTYGCLAL GYSP..AGAS  VSWKKDDIKLET..GVKGYPAVFNKL......GTYTRSSELTITEAA...AAGGDIFCVVQHN....HNEYKVKVQLP  
  M29676  ,IGHM2       APSAPSLFILFTCEDHGS...SGSFTYGCLVL GYSP..AGAS  VSWKKDDKQLTT..GVKDYPAVFNKL......GTYTRSSELTIAEAE...AGRGDIVCVVQHD....QKEYETPLP
  M29672  ,IGHR1 c  (E)DVVLPSVHITSSCNTES....GQEISILCLVK DYLP..EVIS  QTWSTSSGVINN..GITKYPPVLGQN......KKYTMSSLLRVSVADW...NRKTYYCKAGYKP...DNMVKTEIQK
  CH2
  M29679  ,IGHM1 c (D)RVVHHPTVTITITALDEIKR..QGKAIAVCLVN DFTP..AIFT  VNWLKNGKPLDS..GIVTSPAFQVNGT.....GNFSATSQLTFTAEEW..FGDFVYTCQVNHE....KDLKSQNISMPP  
  M29674  ,IGHM2   (E)LAVQHPTVTIAITAHDEIKR..SKKAIAVCLVN DFTP..AKFT  VNWLKNGAPLDS..DIVTSPAFQVNGN.....GNFSATSQLTFPAGEW..FSGSVYTCQVDHG....KYLKSQNISRPG  
  M29672  ,IGHR1 c    (P)QAPQLIPLVPSPETLHN..QTTAVLGCMIS GFSP..DNIK  VSWKKAGLNQA...GVVLPSTPRTNG.......GFETVAYLPLNVEEW..TNKQEYTCEVTHAP..SGFSDKINMRYQEGGKCPGCSKCLPKFIYQSNLNVSFSDGSTQQYHCWAGKCEIK
  CH3
  M29679  ,IGHM1 c (D)VSCDKLSITILPPQVEQELM..EMTVTLTC.LV SDAP..YGIT  VSWKRGNVPL....VSYIQPTGPA..........DIVQSKVNISTQDW..LSGDYFECAVSHAD..MPKPKTERINWKK  
  M26675  ,IGHM5     GIPCVDLKITMLPPPVEQELM..EMTVTLTCYRV SHAP..YGIT  VSWSHMKKHL....ESEIQPTGHE..........DIVESKVNISTRDW..LSGDYFECEVSHDE..MPTPKTGRINWNK

  CH4
  M29679  ,IGHM1 c (G)QHLLPPSVSVLLPPTEEISA..HKTITLTCFVR GFSP..RRVF  VTWTLDDKRVDES.KYKNTEVEAENGN.....DTFFTYSLLSVGAEEW..ASGASFSCLVGHEA.LPMKTIVRTVNKSSGKPSFVNVSLVLMDTVNSCQ  
  M26677  ,IGHM6      QHLLPPSVSILLPPTEEISA..HKTITLTCFVR GFSP..RRVF  VTWTLDDKRVDES.KYKNTEVVAENGN.....DTFFTYSLLSIGAEEW..ASGASFSCLVGHEA.LPMKTIVRTVNKSSGKPSFVNVSLVLMDTVNSCQ 
  

                                             M1                    M2
  M29678  ,IGHM6      YADNVPLEDYEEDRDNIWTTASTFIILFFLSISYGAAVTLVK  VK
                     CONNECTING_REGION| TRANSMEMBRANE-REGION      |CYTOPLASMIQUE REGION
c: cDNA sequence


Created: Friday, 27-May-2016 21:03:27 CEST
Author: Dominique Scaviner