Protein display: African lungfish (Protopterus aethiopicus) IGH C-REGIONs

The IGHC protein display numbering is according to the IMGT unique numbering for C-DOMAIN and C-LIKE-DOMAIN.

Only the *01 allele of each functional, ORF and in-frame pseudogenes C-REGION is shown.

Letters in red correspond to amino acids which are polymorphic in the other alleles.
For C-REGIONs, letters in bold correspond to additional positions in the IMGT unique numbering.
For C-REGIONs, letters between parentheses correspond to amino acids resulting from the splicing.

N (Asn, asparagine) of potential N-glycosylation sites (NXS/T, where X is different from P), (N-linked glycosylation) is shown is green (site is underlined in CHS and in pages edited before 14/10/2009).

_____________________________________________________________________________________________________________________________________________________________________________________________

      IGHC
      genes
_____________________________________________________________________________________________________________________________________________________________________________________________
                                            A        AB     B          BC         C      CD     D          DE           E      EF   F            FG          G
                                     -------------->   ---------->             ------>       ------->              ----------->  ------->               ---------->
                           1       10   15  16  20 23      30    36 39 41 45      77     84             85  89     96 97    104    110      118  121    130       140       150
                              7654321|........|....|123|...|...... ...|.....|  |.....|1234567|......|12345677654321|..........|12|....... .....|....... ..|.........|.........|.........|

CH1
c AF437724,IGHM	                 AQKAAPTVFPVASCSEPSP...DGFISLGLLAT EFLP..NDVS  FTWRSQLSIDAS..LFLPKTYPSVISA....KGTYIGSSQLLLPFTEC..QKPNNIFC EVKHS....LGEK VYSVICP
c AF437727,IGHW	                 ATPSGPSVYPVSPCCDVQKS..QDPLKIGCFVT ADSP...SDN  IQWFLGSSQISS..GVTQYPEVYSNG.......RYSLSSVLNLKSADW...NDKSYEC RFGTQ...KKPVQ KRGCKED
CH2
c AF437724,IGHM	                DFTVILPKVSIFLPATQE.....STFINLVCLVE GFRP..KNAK  VTWSKNRQPVNT..GVLTFATVLDEN......KNFTTTSSLRITREDW..NKEAEFMC QASHPR..WNETV TKNISKPLV
c AF437727,IGHW	                 CPNKIPKIELYMASCEPDD...PKNMYLFCDLS DFAP..EDIE  VAWFRGTSTVT...DFITIGNVTEVNK.....CSFHTSSKLKLVPEDW..SNGMEYKC LATHS....TKSV EKKISSCTA
CH3
c AF437724,IGHM	               PGSTLEDVKVIGIAPSIEDILL..AKSAHVSCLVY GLLSP.ENCN  ISWARSSEPKKS..FKFPFEEIPNEN......GTFSIISKMPICPAEW..NSEEEFTC IVEHES..LPTPE RVTIKKHNG
c AF437727,IGHW	                 CPKPSPTIELMKSSYRDFFT..KKKGTLTCNVT SFLK..NTIV  ILKQDNRDLV....KKQLSSSEATGN......GTWNVHISFDISEADW....RKTFIC EAQHT....CKTD KKTLN
CH4
c AF437724,IGHM	                 GILKKPKIVLLPPTSEDLSN..SETVTLTCLVK GFSP..ADLF  LKWHHNGAPVPD..AEYSDTNKLQDAG....NESFSMYSKLEIRVEDW..NNGHSFTC IVGHE....SLDL NVSSKTIDKSSGKPSSVNVTVIMSDTAGAY
c AF437727,IGHW	                  PEETKEQKKPSVKIHKAVS..SIFNTLICIIS GYYP..DEIF  VKWEQNGHPGNT..EASTHPAVYDKAS.....KSYTMQSILLIPIEDV..KEASIWSC MVGHSALSEMMSD STEVKPF
CH5
c AF437727,IGHW	                AQPKVPPTVAISEPSADENN...EQRLNIDCIAY GFFP..KNIA  IQWLSQEPKKL...LVKTFDVELGES......GTYSIKSILNLSKEEW...HEGQFTC DVKHEA..TKTRI LRNTTNTHACS
CH6
c AF437727,IGHW	                 EYMAAPDVYTIKPSYEDIVI..NRKATLTCLVV GYEL..DSVN  ITWTENDSLIT...DGISSNTEIHSN......GTETVKGLLGIPADDW..LNGRKYSC KVAHSA..LPTPK LMDMWFEEGST
CH7
c AF437727,IGHW	              ETKSKTRAPEVNLRLPTPEEVKK..DENLTLICLIE NYFP..DYVF  VQWRENNTRIHSS.NYRNSDSYFNQKT.....NAYTMDSKLVVQTKDW..DEGKTYTC MVNH.....ISST WTIFKEGNKHTGKPTTVNLSVYLTEGKRECHV

                               M1                                M2
c AF437735,IGHM                       EHVYIVENVADDDSDSLWSTASTFIILFLISLLYSAGVTVFK VK
                                   CONNECTING_REGION  |  TRANSMEMBRANE-REGION | CYTOPLASMIC-REGION
c: cDNA sequence

IMGT note:
5' and 3' end of exons need to be confirmed with genomic sequence.


Created: 23/07/2003
Author: Nathalie Bosc