Protein display: Chimpanzee (Pan troglodytes) IGH C-REGIONs

The IGHC protein display numbering is according to the IMGT unique numbering for C-DOMAIN and C-LIKE-DOMAIN.

Only the *01 allele of each functional, ORF and in-frame pseudogenes C-REGION is shown.

N (Asn, asparagine) of potential N-glycosylation sites (NXS/T, where X is different from P), (N-linked glycosylation) is shown is green (site is underlined in CHS and in pages edited before 14/10/2009).

The hinge exon(s) are shown at the end of the protein display.

_____________________________________________________________________________________________________________________________________________________________________________________________

      IGHC
      genes
_____________________________________________________________________________________________________________________________________________________________________________________________
                                    A        AB     B          BC         C      CD     D          DE           E      EF   F            FG          G
                -------------->   ---------->             ------>       ------->              ----------->  ------->               ---------->
                1       10   15  16  20 23      30    36 39 41 45      77     84             85  89     96 97    104    110      118  121    130       140       150
                      7654321|........|....|123|...|...... ...|.....|  |.....|1234567|......|12345677654321|..........|12|....... .....|....... ..|.........|.........|.........|
CH1
  X53702  ,IGHA1       (A)SPTSPKVFPLSLDSNPQ....DGNVVVACLVQ GFFPQ.EPLS  VTWSESGQGV....TATNFPPSQDASG.....DLYTTSSQLTLPATQC..LAGKSVTC HVKHY...TNPSQ DVTVPCR
X53706  ,IGHA2       (A)SPTSPKVFPLSLDSNPQ....DGNVVVACLVQ GFFPQ.EPLS  VTWSESGQNV....TATNFPPSQDASG.....DLYTTSSQLTLPATQC..LAGKSVTC HVTHY...TNPSQ DVTVPCR
M15398  ,IGHE        (A)PTRSPSLFPLTRCCKNIPSN.ATSVTLGCLAM GYFP..EPVM  VTWDAGSLNG....TTMTLPATTLTPS.....GHYATISLLTVSGAW....AKQMFTC RVAHTPSSTDWVD NKTFS
X65284  ,IGHG1 c     (A)STKGPSVFPLAPSSKSTS...GGTQALGCLVK DYFP..EPVT  VSWNSGALTS....GVHTFPAVLQSS......GLYSLSSVVTVPSSSL...GTQTYIC NVDHKP..SNTKV DKKV
AF300436,IGHG2                                                                           AVLQSS......GLYSLSSVVAVPSSNF...GTQTYTC NVDHKP..SNTKV DKTV
AF300434,IGHG3                                                                           AVLQSS......GLYSLSSVVTVPSSSL...GTQTYIC NVDHKP..SNTKV DKRV
AF300432,IGHG4                                                                           AVLQSS......GLYSLSSVVTVPSSSL...GTQTYTC NVDHKP..SNTKV DKTV
AF300430,IGHGP                                                                           AVLQSS......GLYSLSSVVTVPSSSL...GTQTYTC NVDHKP..SNTKV DKRV
CH2
  X53702  ,IGHA1 (1)       CCHPRLLLHRPALEDLLL..GSEANLTCTLT GLRDA.SGAT  FTWSPSSGKS....AVQGPPERDLCG.......CYSVSSVLPGCAEPW..NHGETFTC TAAYPE..SKTPL TANITKS
  X53706  ,IGHA2 (1)       CCHPRLSLHRPALEDLLL..GSEANLTCTLT GLRDA.SGAT  FTWTPPSGKS....AVQGPPERDLCG.......CYSVSSVLPGCAQPW..NHGETFTC TAAHPE..LKNPL TANITKS
  M15398  ,IGHE	     (V)CSRDFTPTVKVLQSSCDGGGHF.PPTIQLLCLVS GYTP..GTIN  ITWLEDGQVMD...VDLSTASATQEG......ELASTQSELTLSQKHW..LSDRTYTC QVTYQ....GGTF EDSTKKCA
X61311  ,IGHG1 c   (A)PELLGGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSHEDPEVK  FNWYVDGVEVH...NAKTKPREEQYN......STYRVVSVLTVLHQDW..LNGKEYKC KVSNKA..LPAPI EKTISKAK
  AF300436,IGHG2      (A)LPVAGPSVFLFPPKPKDTLMI.SRTPEVTC
  AF300434,IGHG3     (A)PELLGGPSVFLFPPKPKDTLMI.TRTPEVTC
  AF300432,IGHG4     (A)PEFLGGPSVFLFPPKPKDTLMI.SRTPEVTC
  AF300430,IGHGP     (A)PELLGGPSVFLFPPKPKDTLMI.SRTPEVTC
CH3
  X53702  ,IGHA1       (G)NTFRPEVHLLPPPSEELAL..NELVTLTCLAR GFSP..KDVL  VRWLQGSQELPRE.KYLTWASRQEPSQG...TTTFAVTSILRVAAEDW..KKGDTFSC MVGHEA.LPLAFT QKTIDRLA...GKPTHVNVSVVMAEVDGTCY
  X53706  ,IGHA2       (G)NTFRPEVHLLPPPSEELAL..NELVTLTCLAR GFSP..KDVL  VRWLQGSQELPRE.KYLTWASRQEPSQG...TTTYAVTSILRVAAEDW..KKGDTFSC MVGHEA.LPLAFT QKTIDRLA...GKPTHINVSVVMAEVDGTCY
  M15398  ,IGHE	      (D)SNPRGVSAYLSRPSPFDLFI..RKSPTITCLVV DLAPSKGTVN  LTWSRASGKPV...NHSTRKQEKQRN......GTLTVTSTLPVGTRDW..IEGETYQC RVTHPH..LPRAL VRSTTKTS
X61310  ,IGHG1 c     (G)QPREPQVYTLPPSRDELT...KNQVSLTCLVK GFYP..SDIA  VEWESSGQPEN...NYKTTPPVLDSD......GSFFLYSKLTVDKSRW..QQGNVFSC SVMHEA.LHNHYT QKS
CH4
  M15398  ,IGHE        (G)PRAAPEVYAFATPEGPGS...RDKRTLACLIQ NFMP..EDIS  VQWLHNEVQLPDA.RHSTTQPHKTKG......SGFFVFSRLEVTRAEW..EQKDEFIC RAVHEAASPSQTV QRTVSVNP...GK
Hinge
  X53702  ,IGHA1	(V)PSTPCPPTPSTPPTPSPS
  X53706  ,IGHA2	(V)PPPPP
X65285  ,IGHG1  c	(E)PKSCDTTHTCPPCA
  AF300436,IGHG2           (E)RKCCVECPPCP
  AF300434,IGHG3 [H1] (E)LKTPLGDTTHTCPRCP    [H2] (E)PKSCDTPPPCPRCP
  AF300432,IGHG4           (E)SKYGPQCPSCP
  AF300430,IGHGP      (E)PKTPCCDTTHTCPPCA

c: cDNA sequence

IMGT note:
(1) In the IGHA gene, the hinge (H) and CH2 are joined in a single exon.


Created: 12/11/2002
Author: Nathalie Bosc