Protein display: tiger puffer (Takifugu rubripes) TRA C-REGIONs

The TRA protein display numbering is according to the IMGT unique numbering for C-DOMAIN and C-LIKE-DOMAIN.

Letters in red correspond to amino acids which are polymorphic in the other alleles.
For C-REGIONs, letters in bold correspond to additional positions in the IMGT unique numbering.
For C-REGIONs, letters between parentheses correspond to amino acids resulting from the splicing.

N (Asn, asparagine) of potential N-glycosylation sites (NXS/T, where X is different from P), (N-linked glycosylation) is shown is green (site is underlined in CHS and in pages edited before 14/10/2009).

_____________________________________________________________________________________________________________________________________________________________________________________________

      TRA C-GENEs
____________________________________________________________________________________________________________________________________________________________________________________________
A        AB     B           BC        C      CD      D          DE           E      EF   F           FG             G  
                           -------------->   ---------->             ------>       ------->              ----------->  ------->                ------------>
                           1       10   15  16  20 23 26   30    36 39 41 45      77     84             85  89     96 97    104    110      118 121     130
                   87654321|........|....|123|...|...... ...|.....|  |.....|1234567|......|12345677654321|..........|12|....... .....|....... ..|.........|
EX1
  AF110525,TRAC        (G)DQYQPSFYKLK.........HGNTSACLAT GFSR..FHQL  QNNTLFS.......QSKAVLISQDS........LFNQVAFMDQDA.......DGETSC ...........PE

EX2
  AF110525,TRAC	       (D)ENEGAVRCDDALQP 

EX3
  AF110525,TRAC        (D)PLVNLVSLMVTGLRVLLLKTMIFNILMTLRLRISQ

CONNECTING-REGION  TRANSMEMBRANE-REGION   CYTOPLASMIC-REGION




Created: 30/06/2003
Author: Nathalie Bosc