Protein display: Gorilla (Gorilla gorilla) IGH C-REGIONs

The IGHC protein display numbering is according to the IMGT unique numbering for C-DOMAIN and C-LIKE-DOMAIN.

Letters in red correspond to amino acids which are polymorphic in the other alleles.
For C-REGIONs, letters in bold correspond to additional positions in the IMGT unique numbering.
For C-REGIONs, letters between parentheses correspond to amino acids resulting from the splicing.

N (Asn, asparagine) of potential N-glycosylation sites (NXS/T, where X is different from P), (N-linked glycosylation) is shown is green (site is underlined in CHS and in pages edited before 14/10/2009).

The hinge exon(s) are shown at the end of the protein display.

_____________________________________________________________________________________________________________________________________________________________________________________________

      IGHC
      genes
_____________________________________________________________________________________________________________________________________________________________________________________________
                                    A        AB     B          BC         C      CD     D          DE           E      EF   F            FG          G             CHS
                -------------->   ---------->             ------>       ------->              ----------->  ------->               ---------->
                1       10   15  16  20 23      30    36 39 41 45      77     84             85  89     96 97    104    110      118  121    130       140       150
                      7654321|........|....|123|...|...... ...|.....|  |.....|1234567|......|12345677654321|..........|12|....... .....|....... ..|.........|.........|.........|
CH1
  X15045  ,IGHA1       (A)SPTSPKVFPLSLCSTQP....DGDVVVACLVQ GFFPQ.EPLS  VTWSESGQGV....TARNFPPSQDASG.....DLYTTSSQLTLPATQC..PDGKSVTC HVKHY...TNPSQ DVTVPCR
X53707  ,IGHA2       (A)SPTSPKVFPLSLDSTQP....DGNVVVACLVQ GFFPQ.EPLS  VTWSESGQNV....TVRNFPPSQDASG.....DLYTMSSQLTLPATQC..PDCKSVTC HVNHY...TNSSQ DVTVPCR
AF300449,IGHG1                                                                           AVLQSS......GLYSLSSVVTVPSSSL...GTQTYIC NVNHKP..SNTKV DKKV
AF300448,IGHG2                                                                           AVLQSS......GLYSLSSVVTVPSSSL...GTQTYTC NVDHKP..SNTKV DKRV
AF300447,IGHG3                                                                           AVLQSS......GLYSLSSVVTVPSSSL...GTQTYTC NVNHKP..SNTKV DKRV
AF300446,IGHG4                                                                           AVLQSS......GLYSLSSVVTVPSSSL...GTQTYTC NVDHKP..SSTKV DKRV
AF300445,IGHGP                                                                           AVLQSS......GLYSLSSVVTVPSSSL...GTQTYTC NVDHKP..SNTKV DKRV
CH2
  X15045  ,IGHA1 (1)       CCHPRLSLHRPALEDLLL..GSEANLTCTLT GLRDA.SGVT  FTWTPSSGKS....AVEGPPERDLCG.......CYSVSSVLPGCAEPW..NHGKTFTC TAAYPE..SKTPL TATLSKS
  X53707  ,IGHA2 (1)       CCHPRLSLHRPALEDLLL..GSEANLTCTLT GLRDA.SGAT  FTWTPSSGKS....AIQGPPERDLCG.......CYSVSSVLPGCAEPW..KNGKTFTC TAAHPE..SKTPL TANITKS
  AF300449,IGHG1     (A)PELLGGPSVFLFPPKPKDTLMI.SRTPEVTC
  AF300448,IGHG2      (A)PPVAGPSVFLFPPKPKDTLMI.SRTPEVTC
  AF300447,IGHG3     (A)PELLGGPSVFLFPPKPKDTLMI.SRTPEVTC
  AF300446,IGHG4     (A)PEFLGGPSVFLFPPKPKDTLMI.SRTPEVTC
  AF300445,IGHGP     (A)TEPLGGPSVFVFPPKPKDTLMI.SRTPEVTC
CH3
  X15045  ,IGHA1       (G)NMFRPEVHLLPPPSEELAL..NELVTLTCLAR GFSP..KDVL  VRWLQGSQELPRE.KYLTWASRQEPSQG...TTTFAVTSILRVAAEDW..KKGDTFSC MVGHEA.LPLAFT QKTIDRLA...GKPTHVNVSVVMAEVDGTCY
  X53707  ,IGHA2       (G)NMFRPEVHLLPPPSEELAL..NELVTLTCLAR GFSP..KDVL  VRWLQGSQELPRE.KYLTWASRQEPSQG...TTTFAVTSILRVAAEDW..KKGDTFSC MVGHEA.LPLAFT QKTIDRLA...GKPTHVNVSVVMAEVDGTCY
Hinge
  X15045  ,IGHA1*01	    (V)PSTPPTPSPSTPPTPSPP
  X08044  ,IGHA1*02	    (V)PSTPPTPSPP
  X53707  ,IGHA2	    (V)PPSPP
  AF300449,IGHG1       	    (E)PKSCDTTHTCPPCA
  AF300448,IGHG2            (E)PKCCVECPPCP
  AF300447,IGHG3       [H1] (E)LKTPLGDTTHTCPQCP    [H2] (E)PKSCDTSPPCPRCP
  AF300436,IGHG4            (E)SKYGPPCPRCP
  AF300445,IGHGP            (E)PKTPCCDTTHTWPPCA

IMGT note:
(1) In the IGHA gene, the hinge (H) and CH2 are joined in a single exon.


Created: 12/11/2002
Author: Nathalie Bosc