IMGT Web resources: IMGT repertoire Protein display: Macaque IGH C-REGIONs

The IGHC protein display numbering is according to the IMGT unique numbering for C-DOMAIN and C-LIKE-DOMAIN.

Letters in red correspond to amino acids which are polymorphic in the other alleles.
For C-REGIONs, letters in bold correspond to additional positions in the IMGT unique numbering.
For C-REGIONs, letters between parentheses correspond to amino acids resulting from the splicing.

N (Asn, asparagine) of potential N-glycosylation sites (NXS/T, where X is different from P), (N-linked glycosylation) is shown is green (site is underlined in CHS and in pages edited before 14/10/2009).

The hinge exon(s) are shown at the end of the protein display.

_____________________________________________________________________________________________________________________________________________________________________________________________

      IGHC
      genes
_____________________________________________________________________________________________________________________________________________________________________________________________
                                                 A        AB     B          BC         C      CD     D          DE           E      EF   F            FG          G             CH-S
                                         -------------->   ---------->             ------>       ------->              ----------->  ------->               ---------->
                                         1       10   15  16  20 23      30    36 39 41 45      77     84             85  89     96 97    104    110      118  121    130       140       150
                                  7654321|........|....|123|...|...... ...|.....|  |.....|1234567|......|12345677654321|..........|12|....... .....|....... ..|.........|.........|.........|

       CH1  
Macfas X53705  ,IGHA               (A)SPTRPKVFPLSLEGTQ.....SDNVVVACLVQ GFFPQ.EPLN  VTWSKSGAGV....TVINFPPSQDASG.....GLYTTSSQLTLPAAQC..PARESVTC HVEHY...TNPSQ DVAVPC
Macfas AF045536,IGHG1*01    c      (A)STKGPSVFPLAPSSRSTS...ESTAALGCLVK DYFP..EPVT  VSWNSGSLTS....GVHTFPAVLQSS......GLYSLSSVVTVPSSSL...GTQTYVC NVNHKP..SNTKV DKRV                                                                                                                                                                     
Macfas CS101554,IGHG2*01           (A)STKGPSVFPLASCSRSTS...QSTAALGCLVK DYFP..EPVT  VSWNSGALTS....GVHTFQAVLQSS......GLYSLSSVVTVPSSSL...GTQTYVC NVVHEP..SNTKV DKTV                                                                                                                                                                     
Macfas CS101564,IGHG3*01    c      (A)STKGPSVFPLVSCSRSTS...ESTAALGCLVK DYFP..EPVT  VSWNSGALTS....GVHTFPAVLQSS......GLYSLSSVVTVPSSSL...GTQTYVC NVVHEP..SNTKV DKRV                                                                                                                                                                     
Macfas CS101556,IGHG4*01           (A)STKGPSVFPLASSSRSTS...ESTAALGCLVK DYFP..EPVT  VSWNSGALTS....GVHTFPAVLQSS......GLYSLSSVVTVPSSSL...GTQTYVC NVVHEP..SNTKV DKRV                                                                                                                                                                     
Papcynanu AY125048,IGHG1*01        (A)STKGPSVFPLAPSSRSTS...ESTAALGCLVK DYFP..EPVT  VSWNSGSLTS....GVHTFPAVLQSS......GLYSLSSVVTVPSSSL...GTQTYVC NVNHKP..SNTKV DKKV                                                                                                                                                                     
Papcynanu AY125049,IGHG2*01        (A)STKGPSVFPLASSSRSTS...ESTAALGCLVK DYFP..EPVT  VSWNSGALTN....GVHTFPAVLQSS......GLYSLSSVVTVPSSSL...GTQTYTC NVVHEP..SNTKV DKRV                                                                                                                                                                     
Papcynanu AY125050,IGHG3*01        (A)STKGPSVFPLASSSRSTS...ESTAALGCLVK DYFP..EPVT  VSWNSGALTS....GVHTFPAVLQSS......GLYSLSSVVTVPSSSL...GTQTYVC NVVHEP..SNTRV DKRV                                                                                                                                                                     
Papcynanu AY125051,IGHG4*01        (A)STKGPSVFPLASCSKSTS...ESTAALGCLVK DYFP..EPVT  VSWNSGALTN....GVHTFPAVLQSS......GLYSLSSAVTVPSSSL...GTQTYTC NVVHEP..SNTKV DKRV                                                                                                                                                                     
Certoraty AY544576,IGHG1*01        (A)STKGPSVFPLAPSSRSTS...ESTAALGCLVK DYFP..EPVT  VSWNSGSLTS....GVHTFPAVLQSS......GLYSLSSVVTVPSSSL...GTQTYVC NVNHKP..SNTRV DKRV                                                                                                                                                                     
Certoraty AY544577,IGHG2*01        (A)STKGPSVFPLASCSRSTS...QSTAALGCLVK DYFP..EPVT  VSWNSGSLTS....GVHTFPAVLQSS......GLYSLSSVVTVPSSSL...GTQTYVC NVNHKP..SNTRV DKRV                                                                                                                                                                     
Certoraty AY544578,IGHG3*01        (A)STKGPSVFPLAPSSRSTS...QSTAALGCLVK DYFP..EPVT  VSWNSGALTS....GVHTFPAVLQSS......GLYSLSSVVTVPSSSL...GTQTYVC NVNHKP..SNTRV DKRV                                                                                                                                                                     
Certoraty AY544579,IGHG4*01        (A)STKGPSVFPLASCSRSTS...QSTAALGCLVK DYFP..EPVT  VSWNSGALTS....GVHTFPAVLQSS......GLYSLSSVVTVPSSSL...GTQTYTC NVVHEP..SNTRV DKRV                                                                                                                                                                     
Macnem JQ868732,IGHG1*01           (A)STKGPSVFPLAPSSRSTS...ESTAALGCLVK DYFP..EPVT  VSWNSGSLTS....GVHTFPAVLQSS......GLYSLSSVVTVPSSSL...GTQTYVC NVNHKP..SNTKV DKRV                                                                                                                                                                     
Macnem JQ868733,IGHG2*01           (A)STKGPSVFPLASCSRSTS...QSTAALGCLVK DYFP..EPVT  VSWNSGALTS....GVHTFPAVLQSS......GLYSLSSVVTVPSSSL...GTQTYVC NVVHEP..SNTKV DKRV                                                                                                                                                                     
Macnem JQ868734,IGHG3*01           (A)STKGPSVFPLASSSRSTS...ESTVALGCLVK DYFP..EPVT  VSWNSGALTS....GVHTFPAVLQSS......GLYSLSSVVTVPSSSL...GTQTYVC NVVHEP..SNTKV DKRV                                                                                                                                                                     
Macnem JQ868735,IGHG4*01           (A)STKGPSVFPLASSSRSTS...ESTVALGCLVK DYFP..EPVT  VSWNSGALTS....GVHTFPAVLQSS......GLYSLSGVVTVPSSSL...GTQTYVC NVVHQP..SNTKV DKRV                                                                                                                                                                     
Macmul AY039245,IGHA                   PTKPKVFPLSLEGTQ.....SDNVVVACLVQ GFFPQ.KPLN  VTWSKSGAGV....TVINFPPRQDASG.....GLYTTSSQLTLPAAQC..PASESVTC HVEHY...TNPRQ DVAVPCR
Macmul DQ297181,IGHD        c              DVFPIISACQLPKD..NSPVVLACLIT GYNP..KSVT  VTWHLGTQIQ....NQIMFPETEREG.......SYTTSSQLAPTPPLSQ.QHQGEYKC TVKHTP..SDTSK EKTFRWP                                                                                                                                                                                
Macmul NW_001121238,IGHG1*01       (A)STKGPSVFPLAPSSRSTS...ESTAALGCLVK DYFP..EPVT  VSWNSGSLTS....GVHTFPAVLQSS......GLYSLSSVVTVPSSSL...GTQTYVC NVNHKP..SNTKV DKRV 
Macmul AY292519,IGHG2*01                   SVFPLASCSRSTS...QSTAALGCLVK DYFP..EPVT  VSWNSGALTS....GVHTFQAVLQSS......GLYSLSSVVTVPSSSL...GTQTYVC NVVHEP..SNTKV DKTV
Macmul AY292512,IGHG3*01                   SVFPLASCSRSTS...QSTAALGCLVK DYFP..EPVT  VSWNSGALTS....GVHTFPAVLQSS......GLYSLSSVVTVPSSSL...GTQTYVC NVVHEP..SNTKV DKRV 
Macmul AY292520,IGHG4*01                   SVFPLASSSRSTS...ESTAALGCLVK DYFP..EPVT  VSWNSGALTS....GVHTFPAVLQSS......GLYSLSSVVTVPSSSL...GTQTYVC NVVHEP..SNTKV DKRV 
Macmul AF046784,IGHM        c (m)  (G)SASAPTLFPLVSCENAPLD..TNEVAVGCLAQ DFLP..DSIT  FSWKFKNNSNISK.GVWGFPSVLRGG.......KYAATSQVLLASKDVMQGTDEHVVC KVQHP....NGNK EQNVPLP
       CH2 
Macfas X53705  ,IGHA                   CDKPRLSLRRPALEDLLL..GSEANLTCTLT GLRNP.SGAT  FTWTPSSGKN....AVQQSPKRDPCG.......CYSVSSVLPGCAEPW..NNRVTFTC TAEHPE..LETQL TATISKP
Macfas AF045536,IGHG1*01    c    (A)PELLGGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSQEDPDVK  FNWYVNGAEVH...HAQTKPRETQYN......STYRVVSVLTVTHQDW..LNGKEYTC KVSNKA..LPAPI QKTISKDK   
Macfas CS101554,IGHG2*01         (A).ELLGGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSQEEPDVK  FNWYVDGVEVH...NAQTKPREEQFN......STYRVVSVLTVTHQDW..LNGKEYTC KVSNKA..LPAPK QKTVSKTK   
Macfas CS101564,IGHG3*01    c    (A)PELLGGPSVFVFPPKPKDTLMI.SRTPEVTCVVV DVSQEDPEVQ  FNWYVDGAEVH...HAQTKPRETQYN......STYRVVSVLTVTHQDW..LNGKEYTC KVSNKA..LPAPI QKTISKDK   
Macfas CS101556,IGHG4*01         (A)PELLGGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSQEDPEVQ  FNWYVDGVEVH...HAQTKPRERQFN......STYRVVSVLTVTHQDW..LNGKEYTC KVSNKG..LPAPI EKTISKAK   
Papanuanu AY125048,IGHG1*01      (A)PELLGGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSQEDPDVK  FNWYVNGAEVH...HAQTKPRETQYN......STYRVVSVLTVTHQDW..LSGKEYTC KVSNKG..LPAPI QKTISKDK   
Papcynanu AY125049,IGHG2*01      (A).ELLAGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSQEDPDVK  FNWYVNGVEVH...HAQTKPREEQYN......STYRVVSVLTVTHQDW..LNGKEFTC KVSNKA..LPAPI QKTISKDK   
Papcynanu AY125050,IGHG3*01      (A)PELLGGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSPEDPEVQ  FNWYVDGVEVH...HAQTKPRERQFN......STYRVVSVLTVTHQDW..LNGKEYTC KVSNKA..LPAPI EKTISKAK   
Papcynanu AY125051,IGHG4*01      (A)PELLGGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSQEDPEVQ  FNWYVDGVEVH...NAQTKPLERQFN......STYRVVSVLTITHQDW..LSGKEYTC KVSNKG..LPAPV EKTISKAK   
Certoraty AY544576,IGHG1*01      (A)PELLGGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSQEDPDVK  FNWYVNGAEVH...HAQTKPRETQYN......STYRVVSVLTVTHQDW..LNGKEYTC KVSNKG..LPAPI QKTISKTK   
Certoraty AY544577,IGHG2*01      (A).ELLGGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSQEDPDVK  FNWYVDGVEVH...NAQTKPREEQFN......STYRVVSVLTVTHQDW..LNGKEYTC KVSNKG..LPAPR QKTVSKTK   
Certoraty AY544578,IGHG3*01      (A)PELLGGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSQEDPEVQ  FNWYVNGVEVH...HAQTKPRERQFN......STYRVVSVLTVTHQDW..LNGKEYTC KVSNKG..LPAPI EKTISKAK   
Certoraty AY544579,IGHG4*01      (A)PELLGGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSQEDPEVQ  FNWYVDGVEVH...HAQTKPRERQFN......STYRVVSVLTVTHQDW..LNGKEYTC KVSNKG..LPAPV EKTISKAK   
Macnem JQ868732,IGHG1*01         (A)PELLGGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSQEDPDVK  FNWYVNGVEVH...HAQTKPRETQYN......STYRVVSVLTVTHQDW..LNGKEYTC KVSNKA..LPAPI QKTISKDK   
Macnem JQ868733,IGHG2*01         (A).ELLGGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSQEEPDVK  FNWYVDGVEVH...NAQTKPREEQFN......STYRVVSVLTVTHQDW..LNGKEYTC KVSNKG..LPAPR QKTVSKAK   
Macnem JQ868734,IGHG3*01         (A)PELLGGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSQEDPEVQ  FNWYVNGVEVH...HAQTKPRERQFN......STYRVVSVLTVTHQDW..LNGKEYTC KVSNKG..LPAPI EKTISKAK   
Macnem JQ868735,IGHG4*01         (A)PEVLGGPSVFLFPPKPKDTLMI.SRIPEVTCVVV DVSQEDPEVQ  FNWYVDGVEVH...NAQTKPRERQFN......STYRVVSVLTVTHQDW..LNGKEYTC KVSNKG..LPAPI EKTISKAK   
Macmul AY039245,IGHA                   CDKPRLSLRRPALEDLLL..GSEANLTCTLT GLRDP.SGAT  FTWTPSSGKN....AVQQSPEHDPCG.......CYSVSSVLPGCAEPW..NNRVTFTC TAEHPE..LETQL TATISKS
Macmul DQ297181,IGHD        c   (E)CPSHTQPLGVYLLPPALQDLWF..QDKVTFTCFVV GSDL..QDAH  LSWEVAGKVPKG..GMEEGPLEQHSN......GSQSQHSRLALPRSLW..NAGTSVTC TLNHPS..LPSQK LMALREP   
Macmul NW_001121238,IGHG1*01     (A)PELLGGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSQEDPDVK  FNWYVNGAEVH...HAQTKPRETQYN......STYRVVSVLTVTHQDW..LNGKEYTC KVSNKA..LPAPI QKTISKDK  
Macmul AY292519,IGHG2*01         (A).ELLGGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSQEEPDVK  FNWYVDGVEVH...NAQTKPREEQFN......STYRVVSVLTVTHQDW..LNGKEYTC KVSNKA..LPAPR QKTVSKTK
Macmul AY292512,IGHG3*01         (A)PELLGGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSQEDPEVQ  FNWYVDGAEVH...HAQTKPRERQFN......STYRVVSVLTVTHQDW..LNGKEYTC KVSNKG..LPAPI EKTISKAK  
Macmul AY292520,IGHG4*01         (A)PELLGGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSQEDPEVQ  FNWYVDGVEVH...NAQTKPRERQFN......STYRVVSVLTVTHQDW..LNGKEYTC KVSNKG..LPAPI EKTISKAK  
Macmul AF046784,IGHM        c (m) (V)LAERPPNVSVFVPPRDGFVGN.PRESKLICQAT GFSP..RQIE  VSWLREGKQVGS..GITTDRVEAEAKES..GPTTFKVTSTLTVSERDW..LSQSVFTC RVDHR....GLTF QKNVSSVCGP
       CH3
Macfas X53705  ,IGHA               (G)NTFRPEVHLLPPPSEELAL..NELVTLTCLAR GFSP..EDVL  VRWLKGTEQLPRD.KYLTWESRKEPSQG...TTTFAVTSILRVAAEDW..KKGDTFSC MVGHEA.LPLAFT QKTIDRLA...GKPTHVNVSVVMAEVDGTCY
Macfas AF045536,IGHG1*01    c      (G)QPREPQVYTLPPSREELT...KNQVSLTCLVK GFYP..SDIV  VEWESSGQPEN...TYKTTPPVLDSD......GSYFLYSKLTVDKSRW..RQGNVFSC SVMHEA.LHNHYT QKSLSLSP...GK
Macfas CS101554,IGHG2*01           (G)QPREPQVYTLPPPREELT...KNQVSLTCLVK GFYP..SDIV  VEWASNGQPEN...TYKTTPPVLDSD......GSYFLYSKLTVDKSRW..QQGNTFSC SVMHEA.LHNHYT QKSLSLSP...GK
Macfas CS101564,IGHG3*01    c      (G)QPREPQVYTLPPSREELT...KNQVSLTCLVK GFYP..SDIV  VEWESSGQPEN...TYKTTPPVLDSD......GSYFLYSKLTVDKSRW..QQGNVFSC SVMHEA.LHNHYT QKSLSLSP...GK
Macfas CS101556,IGHG4*01           (G)QPREPQVYTLPPPREELT...KNQVSLTCLVK GFYP..SDIV  VEWASNGQPEN...TYKTTPPVLDSD......GSYFLYSKLTVDKSRW..QQGNTFSC SVMHEA.LHNHYT QKSLSLSP...GK
papcynanuAY125048IGHG1*01          (G)QPREPQVYTLPPSREELT...KNQVSLTCLVK GFYP..SDIV  VEWESSGQPEN...TYKTTPPVLDSD......GSYFLYSKLTVDKSRW..QQGNVFSC SVMHEA.LHNHYT QKSLSLSP...GK
papcynanuAY125049,IGHG2*01         (G)QPREPQVYTLPPSREELT...KNQVSLTCLVK GFYP..SDIV  VEWESSGQPEN...TYKTTPPVLDSD......GSYFLYSKLTVDKSRW..QQGNVFSC SVMHEA.LHNHYT QKSLSLSP...GK
papcynanuAY125050,IGHG3*01         (G)QPREPQVYTLPPPREELT...KNQVSLTCLIK GFYP..SDIA  VEWESNGQPEN...TYKTTPPVLDSD......GSYFLYSKLTMDKSRW..QQGNVFSC SVMHEA.LHNHYT QKSLSLSP...GK
papcynanuAY125051,IGHG4*01         (G)QPREPQVYTLPPPREELT...KNQVTLTCLVT GFYP..SDIA  VEWESNGQPEN...TYKTTPPVLDSD......GSYFLYSKLTVDKSRW..QQGNVFSC SVMHEA.LHNHYT QKSLSLSP...GK
CertoratyAY544576,IGHG1*01         (G)QPREPQVYTLPPSREELT...KNQVSLTCLVK GFYP..SDIV  VEWESSGQPEN...TYKTTPPVLDSD......GSYFLYSKLTVDKSRW..QQGNVFSC SVMHEA.LHNHYT QKSLSLSP...GK
CertoratyAY544577,IGHG2*01         (G)QPREPQVYTLPPSREELT...KNQVSLTCLIK GFYP..SDIV  VEWESSGQPEN...TYKTTPPVLDSD......GSYFLYSKLTVDKSRW..QQGNVFSC SVMHEA.LHNHYT QKSLSLSP...GK
CertoratyAY544578,IGHG3*01         (G)QPREPQVYTLPPPREELT...KNQVSLTCLIK GFYP..SDIA  VEWESNGQPEN...TYKTTPPVLDSD......GSYFLYSKLTVDKSRW..QQGNVFSC SVMHEA.LHNHYT QKSLSLSP...GK
CertoratyAY544579,IGHG4*01         (G)QPREPQVYTLPPPREELT...KNQVTLTCLVT GFYP..SDIA  VEWESNGQPEN...TYKTTPPVLDSD......GSYFLYSKLTVDKSRW..QQGNVFSC SVMHEA.LHNHYT QKSLSLSP...GK
MacnemJQ868732,IGHG1*01            (G)QPREPQVYTLPPSREELT...KNQVSLTCLVK GFYP..SDIV  VEWESSGQPEN...TYKTTPPVLDSD......GSYFLYSKLTVDKSRW..QQGNVFSC SVMHEA.LHNHYT QKA
MacnemJQ868733,IGHG2*01            (G)QPREPQVYTLPPPREELT...KNQVSLTCLIK GFYP..SDIV  VEWASNGQPEN...TYKTTPPVLDSD......GSYFLYSKLTVDKSRW..QQGNVFSC SVMHEA.LHNHYT Q
MacnemJQ868734,IGHG3*01            (G)QPREPQVYTLPPPREELT...KNQVSLTCLIK GFYP..SDIA  VEWESNGQPEN...TYKTTPPVLDSD......GSYFLYSKLTVDKSRW..QQGNVFSC SVMHEA.LHNHYT Q
MacnemJQ868735,IGHG4*01            (G)QPREPQVYILPPPQEELT...KNQVSLTCLVK GFYP..SDIA  VEWESNGQPEN...TYKTTPPMLDSD......GSYLLYSKLTVNKSRW..QPGNIFTC SVMHEA.LHNHYT Q
Macmul AY039245,IGHA               (G)NTFRPEVHLLPPPSEELAL..NELVTLTCLAR GFSP..EDVL  VRWLKGTEQLPRD.KYLTWESRKEPSQG...TTTFAVTSILRVAAEDW..KKGDTFSC MVGHEA.LPLAFT QKTIDRLA...GK
Macmul DQ297181,IGHD        c       (A)AQAPVRLSLNLLASSDPP..EAASWLLCEVS DFSP..PNIL  LMWLENQREVNTS.WFATTHPTPQPGS.....TMFWAWSVLRVPGPTS..PQPATYTC VVSHEDSRTLLNA SRSLEVS
Macmul NW_001121238,IGHG1*01       (G)QPREPQVYTLPPSREELT...KNQVSLTCLVK GFYP..SDIV  VEWESSGQPEN...TYKTTPPVLDSD......GSYFLYSKLTVDKSRW..QQGNVFSC SVMHEA.LHNHYT QKSLSVSP...GK
Macmul AY292519,IGHG2*01           (G)QPREPQVYTLPPPREELT...KNQVSLTCLVK GFYP..SDIV  VEWASNGQPEN...TYKTTPPVLDSD......GSYFLYSKLTVDKSRW..QQGNTFSC SVMHEA    
Macmul AY292512,IGHG3*01           (G)QPREPQVYILPPPQEELT...KNQVSLTCLVT GFYP..SDIA  VEWESNGQPEN...TYKTTPPVLDSD......GSYFLYSKLTVDKSRW..QQGNTFSC SVMHEA 
Macmul AY292520,IGHG4*01           (G)QPREPQVYILPPPQEELT...KNQVSLTCLVT GFYP..SDIA  VEWESNGQPEN...TYKTTPPVLDSD......GSYLLYSKLTVNKSRW..QPGNIFTC SVMHEA 
Macmul AF046784,IGHM        c (m)  (N)PDTAIRVFAIPPSFASIFL..TKSTKLTCLVT DLATY.DSVT  ITWTRQNGEAL...KTHTNISESHPN......GTFSAVGEASICEDDW..NSGERFRC TVTHTD..LPSPL KQTISRPK
       CH4
Macmul AF046784,IGHM        c (m) (G)VAMHRPDVYLLPPAREQLNL..RESATITCLVT GFSP..ADIF  VQWMQRGQPLSPE.KYVTSAPMPEPQA....PGRYFAHSILTVSEEDW..NTGETYTC VVAHEA.LPNRVT ERTVDKST
       Hinge 
Macarc AB017354,IGHA*01		  (V)PPPKPCL
Macass AB013770,IGHA*01		  (V)LPPNSCL
Macass AB013753,IGHA*02		  (V)SQTKPCL
Macass AB013762,IGHA*03		  (V)PPITPPCPS
Maccyc AB017366,IGHA*01		  (V)PPITPPCPS
Maccyc AB017356,IGHA*02		  (V)SQTKPCL
Macfas X53705  ,IGHA*01		  (V)SETKPCL
Macfas AB013758,IGHA*02		  (V)PPPNSCL
Macfas AB013764,IGHA*03		  (V)PPITPPCPS
Macfas AF045536,IGHG1*01          (E)IKTCGGGSKPPTCPPCP
Macfas CS101554,IGHG2*01          (G)LPCRSTCPPCP
Macfas CS101564,IGHG3*01          (E)FTRPCDDTTPPCPPCP
Macfas CS101556,IGHG4*01          (E)FTPPCPPCP
Macfas CS101552,IGHG1*02          (E)IKTCGGGSKPPTCPPCP
Macfas JQ868729,IGHG2*02          (G)LPCRSTCPPCP
Macfas JQ868730,IGHG3*02          (E)FTRPCDDTTPPCPPCP
Macfas JQ868731,IGHG4*02          (E)FTPPCPPCP
Macfas JQ868728,IGHG1*03          (E)IKTCGGGSKPPTCPPCP
PapcynanuAY125048,IGHG1*01        (E)IKTCGGGSKPPTCPPCP
PapcynanuAY125049,IGHG2*01        (G)HPCRSTCPPCP
PapcynanuAY125050,IGHG3*01        (E)FTPSCDDPTPPCLPCP
PapcynanuAY125051,IGHG4*01        (E)FPSGPNCPLCP
CertoratyAY544576,IGHG1*01        (E)IKTCGGGSKPPTCPPCP
CertoratyAY544577,,IGHG2*01       (G)LPCRSTCPPCP
CertoratyAY544578,,IGHG3*01       (E)FTPSCDDPTPPCLPCP
CertoratyAY544579,,IGHG4*01       (E)FPSGPNCPPCP
Macnem JQ868732,IGHG1*01          (E)IKTCGGGSKPPTCPPCP
Macnem JQ868733,IGHG2*01          (G)RSTCPPCP
Macnem JQ868734,IGHG3*01          (E)FTPSCDDPTPPCLPCP
Macnem JQ868735,IGHG4*01          (E)FTPPCPPCP
Macmul AY039245,IGHA*01		  (V)PPPKCPSLK
Macmul AY039246,IGHA*02		  (V)PPPNCRL
Macmul AY039247,IGHA*03		  (V)PQPKPCL
Macmul AY039248,IGHA*04		  (V)PPITPPCPS
Macmul AY039249,IGHA*05		  (V)PPITPPCPS
Macmul AY039250,IGHA*06		  (V)PPPPNCRL
Macmul AY039251,IGHA*07		  (V)SQTKPCL
Macmul AY039252,IGHA*08		  (V)SQTKPCL
Macmul AB013768,IGHA*09		  (V)PPPNSCL
Macmul AB013769,IGHA*10		  (V)SETKPCL
Macmul AB013757,IGHA*12		  (D)PQPKPCL
Macmul AB013761,IGHA*13		  (G)IPPTPIPLPCPS
Macmul AY294614,IGHA*14		  (V)PPITPPCPS
Macmul AY294616,IGHA*15		  (V)SQTKPCL
Macmul AY294617,IGHA*16		  (V)PPPNSCL
Macmul AY294618,IGHA*17		  (V)PPPNCRL
Macmul AY294620,IGHA*18		  (V)PPITPPCPS
Macmul AY294621,IGHA*19		  (V)PPPNSCL
Macmul AY294623,IGHA*20		  (V)PPPKCPSL
Macnem AB013765,IGHA*01		  (V)PPITPPCPS
Macnem AB013771,IGHA*02		  (V)SQTKPCL
Macsil AB013775,IGHA*01		  (V)SQTKPCL
Macthi AB013752,IGHA*01		  (V)PPPKPCL   
Macmul DQ297181,IGHD          [H1](E)SPKAQYPSVPTVQPQAEGGLSKATRPPATNRNT      [H2] (G)RREKEDEEEKEQQEGETKTP 
Macfas AF045536,IGHG1*01  c       (E)IKTCGGGSKPPTCPPCP
Macmul NW_001121238,IGHG1*01      (E)IKTCGGGSKPPTCPPCPT
Macmul AY292519,IGHG2*01          (G)LPCRSTCPPCP
Macmul AY292512,IGHG3*01  (m)     (E)FTPPCGDTTPPCPPCP
Macmul AY292520,IGHG4*01          (E)FTPPCPPCP
                                     M1                      
Macmul AF045538,IGHG3   c (m)     (E)LQLEESCVEAQDGSWTG
Macmul AF046784,IGHM    c (m)          (E)GEVSADEEGFENLWATASTFIVLFLLSLFYSTTVTLF
                                  CONNECTING_REGION   | TRANSMEMBRANE-REGION     | CYTOPLASMIC-REGION
 
 c: cDNA sequence
 g: gDNA sequence
(m): transcript of a membrane chain


Macarc: Macaca arctoides (Stump-tailed macaque)
Macass: Macaca assamensis (Assam macaque)
Maccyc: Macaca cyclopis (Taiwan macaque)
Macfas: Macaca fascicularis (Crab-eating macaque)
Macmul: Macaca mulatta (Rhesus monkey)
Macnem: Macaca nemestrina (Pig-tailed macaque)
Macsil: Macaca silenus (Liontail macaque)
Macthi: Macaca thibetana (Pere David's macaque)
Papanuanu: Papio anubis anubis (Baboon)
Certoraty: Cercocebus torquatus atys (Sooty mangabey)


Created: 04/11/2002
Author: Saida Saljoqi, Nathalie Bosc

Software material and data coming from IMGT server may be used for academic research only, provided that it is referred to IMGT®, and cited as "IMGT®, the international ImMunoGeneTics information system® http://www.imgt.org (founder and director: Marie-Paule Lefranc, Montpellier, France)." References to cite: Lefranc, M.-P. et al., Nucleic Acids Res., 27:209-212 (1999); doi: 10.1093/nar/27.1.209 Full text Cover; Ruiz, M. et al., Nucleic Acids Res., 28:219-221 (2000); doi: 10.1093/nar/28.1.219 Full text; Lefranc, M.-P., Nucleic Acids Res., 29:207-209 (2001); doi: 10.1093/nar/29.1.207 Full text; Lefranc, M.-P., Nucleic Acids Res., 31:307-310 (2003); doi: 10.1093/nar/gkg085 Full text; Lefranc, M.-P. et al., In Silico Biol., 5, 0006 (2004) [Epub], 5:45-60 (2005); Lefranc, M.-P. et al., Nucleic Acids Res., 33:D593-597 (2005); doi: 10.1093/nar/gki065 Full text; Lefranc, M.-P. et al., Nucleic Acids Res., 37:D1006-1012 (2009); doi: 10.1093/nar/gkn838 Full text; Lefranc, M.-P. et al., Nucleic Acids Res., 43:D413-422 (2015); doi: 10.1093/nar/gku1056 Full text.
For any other use please contact Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr.

CNRS Université de Montpellier European Commission
IMGT® Founder and Executive Director Emeritus:
Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr
IMGT® Director:
Sofia Kossida Sofia.Kossida@igh.cnrs.fr
Bioinformatics manager:
Véronique Giudicelli Veronique.Giudicelli@igh.cnrs.fr
Computer manager:
Patrice Duroux Patrice.Duroux@igh.cnrs.fr
Webmaster:
Amélie Houles

Citing IMGT | Warranty disclaimer and copyright notice | Privacy policy and advertisement policy

© Copyright 1995-2017 IMGT®, the international ImMunoGeneTics information system®