The IGHC protein display numbering is according to the IMGT unique numbering for C-DOMAIN and C-LIKE-DOMAIN.

Letters in red correspond to amino acids which are polymorphic in the other alleles.
For C-REGIONs, letters in bold correspond to additional positions in the IMGT unique numbering.
For C-REGIONs, letters between parentheses correspond to amino acids resulting from the splicing.

N (Asn, asparagine) of potential N-glycosylation sites (NXS/T, where X is different from P), (N-linked glycosylation) is shown is green (site is underlined in CHS and in pages edited before 14/10/2009).

The hinge exon(s) are shown at the end of the protein display.

_____________________________________________________________________________________________________________________________________________________________________________________________

      IGHC
      genes
_____________________________________________________________________________________________________________________________________________________________________________________________
A        AB     B          BC         C      CD     D          DE           E      EF   F            FG          G             CHS
                -------------->   ---------->             ------>       ------->              ----------->  ------->               ---------->
                1       10   15  16  20 23      30    36 39 41 45      77     84             85  89     96 97    104    110      118  121    130       140       150
                   7654321|........|....|123|...|...... ...|.....|  |.....|1234567|......|12345677654321|..........|12|....... .....|....... ..|.........|.........|.........|

CH1

J00475 ,IGHA (1) (E)SARNPTIYPLTLPPVLC....SDPVIIGCLIH DYFPF.GTMN VTWGKSGKDI....TTVNFPPALASG......GRYTMSSQLTLPAVEC..PEGESVKC SVQHD...SNPVQ ELDVNCS V00786 ,IGHD (G)DKKEPDMFLLSECKAPEE...NEKINLGCLVI GSQ....PLK ISWEPKKSSI....VEHVFPSEMRNG.......NYTMVLQVTVLASE....LNLNHTC TINKP...KRKEK PFKFP X01857 ,IGHE (A)SIRNPQLYPLKPCKG......TASMTLGCLVK DYFP..NPVT VTWYSDSLNM....STVNFPALGSE........LKVTTSQVTSWGK.....SAKNFTC HVTHP...PSFNE SRTIL J00453 ,IGHG1 (A)KTTPPSVYPLAPGSAAQT...NSMVTLGCLVK GYFP..EPVT VTWNSGSLSS....GVHTFPAVLESD.......LYTLSSSVTVPSSPR...PSETVTC NVAHPA..SSTKV DKKI V00825 ,IGHG2A (A)KTTAPSVYPLAPVCGDTT...GSSVTLGCLVK GYFP..EPVT LTWNSGSLSS....GVHTFPAVLQSD.......LYTLSSSVTVTSSTW...PSQSITC NVAHPA..SSTKV DKKI V00763 ,IGHG2B (A)KTTPPSVYPLAPGCGDTT...GSSVTSGCLVK GYFP..EPVT VTWNSGSLSS....SVHTFPALLQSG.......LYTMSSSVTVPSSTW...PSQTVTC SVAHPA..SSTTV DKKL J00479 ,IGHG2C (A)KTTAPSVYPLAPVCGGTT...GSSVTLGCLVK GYFP..EPVT LTWNSGSLSS....GVHTFPALLQSG.......LYTLSSSVTVTSNTW...PSQTITC NVAHPA..SSTKV DKKI X00915 ,IGHG3 (A)TTTAPSVYPLVPGCSDTS...GSSVTLGCLVK GYFP..EPVT VKWNYGALSS....GVRTVSSVLQSG.......FYSLSSLVTVPSSTW...PSQTVIC NVAHPA..SKTEL IKRI V00818 ,IGHM (E)SQSFPNVFPLVSCESPLSD..KNLVAMGCLAR DFLP..STIS FTWNYQNNTEVIQ.GIRTFPTLRTGG.......KYLATSQVLLSPKSILEGSDEYLVC KIHYG....GKNR DLHVPIP

CH2

J00475 ,IGHA SCQPSLSLQRPALEDLLL..GSDASITCTLN GLRNP.EGAA FTWEPSTGKD....AVQKKAAQNSCG.......CYSVSSVLPGCAERW..NSGASFKC TVTHPE..SGTLT GTIAKVT X01857 ,IGHE (V)RPVNITEPTLELLHSSCDPNAF..HSTIQLYCFIY GHIL..NDVS VSWLMDDREITD..TLAQTVLIKEEG......KLASTCSKLNITEQQW..MSESTFTC KVTSQ....GVDY LAHTRRCP J00453 ,IGHG1 (V)PEVSSVFIFPPKPKDVLTI.TLTPKVTCVVV DISKDDPEVQ FSWFVDDVEVH...TAQTQPREEQFN......STFRSVSELPIMHQDW..LNGKEFKC RVNSAA..FPAPI EKTISKTK V00825 ,IGHG2A (A)PNLLGGPSVFIFPPKIKDVLMI.SLSPIVTCVVV DVSEDDPDVQ ISWFVNNVEVH...TAQTQTHREDYN......STLRVVSALPIQHQDW..MSGKEFKC KVNNKD..LPAPI ERTISKPK V00763 ,IGHG2B (A)PNLEGGPSVFIFPPNIKDVLMI.SLTPKVTCVVV DVSEDDPDVQ ISWFVNNVEVH...TAQTQTHREDYN......STIRVVSTLPIQHQDW..MSGKEFKC KVNNKD..LPSPI ERTISKIK J00479 ,IGHG2C (A)PDLLGGPSVFIFPPKIKDVLMI.SLSPMVTCVVV DVSEDDPDVQ ISWFVNNVEVH...TAQTQTHREDYN......STLRVVSALPIQHQDW..MSGKEFKC KVNNRA..LPSPI EKTISKPR X00915 ,IGHG3 (P)GNILGGPSVFIFPPKPKDALMI.SLTPKVTCVVV DVSEDDPDVH VSWFVDNKEVH...TAWTQPREAQYN......STFRVVSALPIQHQDW..MRGKEFKC KVNNKA..LPAPI ERTISKPK V00818 ,IGHM (A)VAEMNPNVNVFVPPRDGFSGPAPRKSKLICEAT NFTP..KPIT VSWLKDGKLVES..GFTTDPVTIENKGS..TPQTYKVISTLTISEIDW..LNLNVYTC RVDHR....GLTF LKNVSSTCAA

CH3

J00475 ,IGHA (V)NTFPPQVHLLPPPSEELAL..NELLSLTCLVR AFNP..KEVL VRWLHGNEELSPE.SYLVFEPLKEPGEG...ATTYLVTSVLRVSAETW..KQGDQYSC MVGHEA.LPMNFT QKTIDRLS...GKPTNVSVSVIMSEGDGICY V00788 ,IGHD (G)AMAPSNLTVNILTTSTHP..EMSSWLLCEVS GFFP..ENIH LMWLGVHSKMKST.NFVTANPTAQPG......GTFQTWSVLRLPVALS..SSLDTYTC VVEHEASKTKLNA SKSLAIS (G)CYHLLPESDGPSRRPDGPALA (J00450) X01857 ,IGHE (D)HEPRGVITYLIPPSPLDLYQ..NGAPKLTCLVV DLESE.KNVN VTWNQEKKTSV...SASQWYTKHHNN......ATTSITSILPVVAKDW..IEGYGYQC IVDHPD..FPKPI VRSITKTP J00453 ,IGHG1 (2)(G)RPKAPQVYTIPPPKEQMA...KDKVSLTCMIT DFFP..EDIT VEWQWNGQPAE...NYKNTQPIMNTN......GSYFVYSKLNVQKSNW..EAGNTFTC SVLHEG.LHNHHT EKSLSHSP...GK V00825 ,IGHG2A (G)SVRAPQVYVLPPPEEEMT...KKQVTLTCMVT DFMP..EDIY VEWTNNGKTEL...NYKNTEPVLDSD......GSYFMYSKLRVEKKNW..VERNSYSC SVVHEG.LHNHHT TKSFSRTP...GK V00763 ,IGHG2B (G)LVRAPQVYTLPPPAEQLS...RKDVSLTCLVV GFNP..GDIS VEWTSNGHTEE...NYKDTAPVLDSD......GSYFIYSKLNMKTSKW..EKTDSFSC NVRHEG.LKNYYL KKTISRSP...GK J00479 ,IGHG2C (G)PVRAPQVYVLPPPAEEMT...KKEFSLTCMIT GFLP..AEIA VDWTSNGRTEQ...NYKNTATVLDSD......GSYFMYSKLRVQKSTW..ERGSLFAC SVVHEV.LHNHLT TKTISRSL...GK X00915 ,IGHG3 (G)RAQTPQVYTIPPPREQMS...KKKVSLTCLVT NFFS..EAIS VEWERNGELEQ...DYKNTPPILDSD......GTYFLYSKLTVDTDSW..LQGEIFTC SVVHEA.LHNHHT QKNLSRSP...GK V00818 ,IGHM (S)PSTDILTFTIPPSFADIFL..SKSANLTCLVS NLATY.ETLN ISWASQSGEPL...ETKIKIMESHPN......GTFSAKGVASVCVEDW..NNRKEFVC TVTHRD..LPSPQ KKFISKPN

CH4

X01857 ,IGHE (G)QRSAPEVYVFPPPEEES....EDKRTLTCLIQ NFFP..EDIS VQWLGDGKLISNS.QHSTTTPLKSNGS....NQGFFIFSRLEVAKTLW..TQRKQFTC QVIHEALQKPRKL EKTISTSL...GNTSLRPS V00818 ,IGHM (E)VHKHPPAVYLLPPAREQLNL..RESATVTCLVK GFSP..ADIS VQWLQRGQLLPQE.KYVTSAPMPEPGA....PGFYFTHSILTVTEEEW..NSGETYTC VVGHEA.LPHLVT ERTVDKST...GKPTLYNVSLIMSDTGGTCY

CONNECTING-REGION, TRANSMEMBRANE-REGION and CYTOPLASMIC-REGION

M K00691 ,IGHA (E)RQEPLSYVLLDQSQDILEEEAPGASLWPTTVTFLTLFLLSLFYSTALTVTTVRGPFGSKEVPQY M1 M2 J00450 ,IGHD (G)IVNTIQHSCIMDEQSDSYMDLEEENGLWPTMCTFVALFLLTLLYSGFVTFIK VK X03624 ,IGHE (E)LDLQDLCIEEVEGEELEELWTSICVFITLFLLSVSYGATVTVLK VKWVWLSTPMQDTPQTFQDYANILQTRA J00454 ,IGHG1 (G)LQLDETCAEAQDGELDGLWTTITIFISLFLLSVCYSAAVTLFK VKWIFSSVVELKQTLVPEYKNMIGQAP J00471 ,IGHG2A (G)LDLDDVCAEAQDGELDGLWTTITIFISLFLLSVCYSASVTLFK VKWIFSSVVELKQTISPDYRNMIGQGA J00462 ,IGHG2B (G)LDLDDICAEAKDGELDGLWTTITIFISLFLLSVCYSASVTLFK VKWIFSSVVELKQKISPDYRNMIGQGA X00915 ,IGHG3 (E)LELNETCAEAQDGELDGLWTTITIFISLFLLSVCYSASVTLFK VKWIFSSVVQVKQTAIPDYRNMIGQGA J00444 ,IGHM (E)GEVNAEEEGFENLWTTASTFIVLFLLSLFYSTTVTLFK VK CONNECTING-REGION | TRANSMEMBRANE-REGION | CYTOPLASMIC-REGION

HINGE-REGION

J00475 ,IGHA*01 (G)PTPPPPITIP AF175974,IGHA*04 (G)ICSPPTTPPPP AY045742,IGHA*06 (G)PPPPCPPCPP AY045748,IGHA*07 (G)PPPPCPP AY045751,IGHA*08 (G)PPPPCPPLP V00787 ,IGHD (E)SWDSQSSKRVTPTLQAKNHSTEATKAITTKKDIE J00453 ,IGHG1 (V)PRDCGCKPCICT V00825 ,IGHG2A (E)PRGPTIKPCPPCKCP V00763 ,IGHG2B (E)PSGPISTINPCPPCKECHKCP J00479 ,IGHG2C (E)PRVPITQNPCPPLKECPPCA X00915 ,IGHG3 (E)PRIPKPSTPPGSSCP
IMGT note:
(1)N 122 is polymorphic.
(2)N 84.4 is polymorphic.