Protein display: Bornean orangutan (Pongo pygmaeus) IGH C-REGIONs

The IGHC protein display numbering is according to the IMGT unique numbering for C-DOMAIN and C-LIKE-DOMAIN.

Letters in red correspond to amino acids which are polymorphic in the other alleles.
For C-REGIONs, letters in bold correspond to additional positions in the IMGT unique numbering.
For C-REGIONs, letters between parentheses correspond to amino acids resulting from the splicing.

N (Asn, asparagine) of potential N-glycosylation sites (NXS/T, where X is different from P), (N-linked glycosylation) is shown is green (site is underlined in CHS and in pages edited before 14/10/2009).

The hinge exon(s) are shown at the end of the protein display.

_____________________________________________________________________________________________________________________________________________________________________________________________

      IGHC
      genes
_____________________________________________________________________________________________________________________________________________________________________________________________
                                    A        AB     B          BC         C      CD     D          DE           E      EF   F            FG          G             CHS
                -------------->   ---------->             ------>       ------->              ----------->  ------->               ---------->
                1       10   15  16  20 23      30    36 39 41 45      77     84             85  89     96 97    104    110      118  121    130       140       150
                      7654321|........|....|123|...|...... ...|.....|  |.....|1234567|......|12345677654321|..........|12|....... .....|....... ..|.........|.........|.........|
CH1
X53704  ,IGHA        (A)SPTSPKVFPLNFCSIQP....DGNVVVACLVQ GFFPQ.EPLS  VTWSESGQGV....TARNFPPSQDPTG.....GLYTTSSQLTLPATQC..QDGKSVTC HVKHY...TNPSQ DVTVPCR
M15399  ,IGHE        (A)STQSPSIFPLTHCCKNIPSN.ATSVTLGCLVT GYFP..EPVM  VTWDASSLHG....TTMTLPATTLTPS.....GHYATISLLTVSGAW....AKQMFTC RVAHTPSSADWVY NKTFG
AF300428,IGHG1                                                                           AVLQSS......GLYSLSSVVTVPSSSL...GTQTYIC NVDHKP..SNTKV DKKV
AF300426,IGHG2                                                                           AVLQSS......GLYSLSSVVTVPSSSL...GSQTYTC NVDHKP..SNTKV DKKV
AF300452,IGHG3                                                                           AVLQSS......GLYSLSSVVTVPSSSL...GTQTYTC NVDHKP..SNTKV DKRV
CH2
  X53704  ,IGHA (1)        CGQPQLSLHRPALEDLLL..GSEANLTCTLT GLTNA.SGAT  FTWTPSSGKN....AVQRPPERDLCG.......CYSVSSVLPGCADPW..NHGQTFTC TAEHPE..LKTQL TATLSKS
  M15399  ,IGHE     (V)CSRDFTPPTVKILQSSCDGGGHF.PLTIQLLCLVS GYTP..GTIN  ITWLEDGQVMD...VDLSTASATQEG......ELASTQSELTLSQKRW..LSDRTYTC QVTYQ....GDTF EDSTKKCA
  AF300428,IGHG1     (A)PELLGGPSVFLFPPKPKDTLMI.SRTPEVTC
  AF300426,IGHG2     (G)LTPPEGPSVFLFPPKPKDTLMI.SRTPEVTC
  AF300452,IGHG3     (E)PELLGGPSVFLFPPKPKDTLMI.SGTPEVTC
CH3
  X53704  ,IGHA        (G)NTFRPEVHLLPPPSEELAL..NELVTLTCLAR GFSP..KDVL  VRWLQGSQELPRE.KYLTWASRQEPSQG...TTTYAVTSILRVAAEDW..KKGDTFSC MVGHEA.LPLAFT QKTIDRLA...GKPTHVNVSVVMAEVDGTCY
  M15399  ,IGHE       (D)SNPRGLSAYLSRPSPFDLFI..RKSPTPTCLVV DLAPSKGTVN  LTWSRASGKPV...NHSTGKQEKQRN......GTLTVTSTLPVGTRDW..IEGETYQC RVTHPH..LPRAL VRSTTKTS
CH4
  M15399  ,IGHE        (G)PRAAPEVYAFATPEGPGS...RDKRTLACLIQ NFMP..EDIS  VQWLHNEVQLPDA.RHSTTQPHKTKG......SSFFVFSRLEVTRAEW..EQKDEFIC RAVHEAASPSQTV QRTVSVNP...GK
Hinge
  X53704  ,IGHA	            (V)PRPTPTPSTPPCPPPS
  AF300428,IGHG1       	    (E)PKSCDTPRPCPPCP
  AF300426,IGHG2            (E)LIIPCCDTPRLCPPCP
  AF300452,IGHG3       [H1] (E)LKTPHDDTTHPCTPCP   [H2] (E)PKSCDTPPPCPRCPRCP   [H3] (E)PKSCDTPPTCPRCP

IMGT note:
(1) In the IGHA gene, the hinge (H) and CH2 are joined in a single exon.


Created: 12/11/2002
Author: Nathalie Bosc