Letters in red correspond to amino acids which are polymorphic in the other alleles.
For C-REGIONs, letters in bold correspond to additional positions in the IMGT unique numbering.
For C-REGIONs, letters between parentheses correspond to amino acids resulting from the splicing.

The TRGC protein display numbering is according to the IMGT unique numbering for C-DOMAIN and C-LIKE-DOMAIN.

To take into account the similitude between the organization of the ovine and bovine TRG loci, the ovine C6, C1 and C4 genes, described in [1] have been officially named as TRGC1, TRGC4 and TRGC6, respectively (20/04/2006).

________________________________________________________________________________________________________________________________________________________________

      TRGC
      genes
________________________________________________________________________________________________________________________________________________________________
A                 B         BC         C               D                     E              F               G
                                 --------------->    ---------->             ----->        ----------->       -------------->  ------------->   ---------->
                                  1       10   15  16  20 23      30    36 39 41 45      77     84             85  89     96 97    104   110 114   120       130
                           7654321|........|....|123|...|...... ...|.....|  |.....|1234567|......|12345677654321|..........|12|............|...|.....|.........|
EX1
AF312559,TRGC1*01     (E)RNLAADTSPKPTVFLPSIAEINH..DNAGTYLCLLE KFFP..DVIT  VSWRVKNDKRAL..PSQQGNTMKTK.......DTYMKLSWLTVTEN....SMDKQHVCVVKHQKNIGGIDQEIIFPSIKE
Z12965  ,TRGC2*01     (E)RNLAADTSPKPTVFLPSIAEINH..DNAGTYLCLLE KFFP..DVIT  VSWRVKNDKRAL..PSQQGNTMKTK.......DTYMKLSWLTVTEN....SMDKQHVCVVKHQKNIGGIDQEIIFPSIKE
Z12966  ,TRGC3*01     (D)RDLDKDMSPKPTMFLPSITEIKR..DNSGTYLCLLE DFFP..HVIK  VYWREKRGNKVL..PSQEGKTIKTL.......DTYMKFSWLTVSGN....SMDKEHMCIVKHEKNKRGTNQEILFPAVNE
Z12964  ,TRGC4*01     (N)RNLATDLSPKPIIFLPSIAEINH..SKTGTYLCLLE KFFP..DIIK  VYWKEKDGNRAL..PSQQGNTMNTT.......DTYMKLSWLTVTEN....SMDKEHICVVQHERNIRGINQEILFPSINE
Z13986  ,TRGC5*01     (D)RRLDGDLFPKPTIFFPSVEEVKR..HSAGTHLCLLQ NFFP..DAIK  VQWKEKNGNTIL..ESHQGNIIKTN.......DTYMKFSWLTLTKK....AMGKEHVCIVKHENNKGGRDQEILFSPVNK
AF241307,TRGC6*01     (D)KNLPTDIIPKPTIFLPSINEVNH..QQTATYLCLLE NFFP..DVIK  VSWKEKNGKRVL..PSQQGNTMKTN.......NTYMKFSWLTVTED....SMKKEHMCIVRLEKNAGGKDQEILFPAVNE



CONNECTING-REGION                                                                        TRANSMEMBRANE-REGION      CYTOPLASMIC-REGION
[EX2A]                           [EX2B]              [EX2C]              [EX3]
  AF312560/1,TRGC1*01   (V)VTSAVTTTKPP..........NDCLTDES                                         (S)ALRLQLTTTSAYNTYLLLLLLSTVYFVVIISCVFRRTGVWSDWKIS
  Z12965    ,TRGC2*01   (V)VTSAVTTTEPPTTEPPTTEPPNDCLTDES (K)VTGTGSKTACLKDER  (E)VTGDTNSTKACQEGES (S)ALRLQLTTTSAYYTYLLLLLLSTVYFVVIISCVFRRTGNCCDGKIS
  Z12966    ,TRGC3*01   (V)VSSVVTTTKPPNDGLKDKS                              (E)KQVPVANSTKACLKDEN (N)TLQLQLMSTSAYYTYLLLLIKSTAYFAIITSCVFRRTGVCGNQKSS
  Z12964    ,TRGC4*01   (V)VSSIVPTTESPSDCLNQES           (K)VTGTGSKKACLKDES  (E)VTADNNSTKVCLEDES (N)TLQLQLMNTSAYYTYLLLLLKSVVYFIIITSCVFRRTGMCCDGKNL
  Z13986    ,TRGC5*01   (E)VATHACMKKGS                                                           (D)TLQLQFASTSAYYTYLLLLLKSMIYFSIIAFCVFWRIGIFSNGKIF
  AF241308/9,TRGC6*01   (V)FSPVVATTEPPDDCLQDES           (E)VTDTDFTKVCSRGES     (E)VTDSTKACLKDEN (N)TVELQLAYNSAYYTYLLLLLKSAIYFVTSSCCVFRRTGVCHDGKSS

Reference:
[1] Miccoli, M.C. et al., J. Mol. Evol. 57, 52-62 (2003). PMID: 12962306