Protein display: Turbot (Scophthalmus maximus) IGH V-REGIONs

Only the *01 allele of each functional, ORF and in-frame pseudogene V-REGION is shown.

Dots indicate gaps according to the IMGT unique numbering. Blanks at the 5' and/or 3' end indicate partial sequences.


       IGHV                          FR1-IMGT           CDR1-IMGT       FR2-IMGT      CDR2-IMGT                 FR3-IMGT                  CDR3-IMGT
       gene                           (1-26)             (27-38)        (39-55)        (56-65)                  (66-104)                  (105-115)
___________________________ __________________________ ____________ _________________ __________ _______________________________________ ___________
                            1       10        20         30         40        50         60         70        80        90        100        110
                            .........|.........|...... ...|........ .|.........|..... ....|..... ....|.........|.........|.........|.... .....|.....

#c AJ296096,IGHV1S1                                                           GMHWIGM RSTGVS.... YYKDSLK.NKFSIDLDTCSKTVTLNGQNVQPEDTAVYYC AK.........

#c Rearranged cDNA

Created: 15/11/2001
Author: Nathalie Bosc

Software material and data coming from IMGT server may be used for academic research only, provided that it is referred to IMGT®, and cited as "IMGT®, the international ImMunoGeneTics information system® (founder and director: Marie-Paule Lefranc, Montpellier, France)." References to cite: Lefranc, M.-P. et al., Nucleic Acids Res., 27:209-212 (1999); doi: 10.1093/nar/27.1.209 Full text Cover; Ruiz, M. et al., Nucleic Acids Res., 28:219-221 (2000); doi: 10.1093/nar/28.1.219 Full text; Lefranc, M.-P., Nucleic Acids Res., 29:207-209 (2001); doi: 10.1093/nar/29.1.207 Full text; Lefranc, M.-P., Nucleic Acids Res., 31:307-310 (2003); doi: 10.1093/nar/gkg085 Full text; Lefranc, M.-P. et al., In Silico Biol., 5, 0006 (2004) [Epub], 5:45-60 (2005); Lefranc, M.-P. et al., Nucleic Acids Res., 33:D593-597 (2005); doi: 10.1093/nar/gki065 Full text; Lefranc, M.-P. et al., Nucleic Acids Res., 37:D1006-1012 (2009); doi: 10.1093/nar/gkn838 Full text; Lefranc, M.-P. et al., Nucleic Acids Res., 43:D413-422 (2015); doi: 10.1093/nar/gku1056 Full text.
For any other use please contact Marie-Paule Lefranc

CNRS Université de Montpellier European Commission
IMGT® Founder and Executive Director Emeritus:
Marie-Paule Lefranc
IMGT® Director:
Sofia Kossida
Bioinformatics manager:
Véronique Giudicelli
Computer manager:
Patrice Duroux
Amélie Houles

Citing IMGT | Warranty disclaimer and copyright notice | Privacy policy and advertisement policy

© Copyright 1995-2019 IMGT®, the international ImMunoGeneTics information system®