Here you are: IMGT Web resources > IMGT Repertoire (RPI) > 2. Proteins and alleles
______________________________________________________________________________________________________________________________________________________________________________________________

      IGLL
      genes
______________________________________________________________________________________________________________________________________________________________________________________________
  
                                  1       10        20        30        40        50        60        70
                                  ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|
  M27749  ,IGLL1  EX1             MRPGTGQGGLEAPGEPGPNLRQRWPLLLLGLAVVTHGLLRPTAASQSRALGPGAPGGSSRSSLRSRWG
  X52203  ,IGLL2  EX1  (2)        MCHSGSCWDLLGPALPSAPTASERGTYAGVTPRLWAAPASDREQAQRHYWGTLLGYWPPPCPVPGSQPTHCSPVPLTPS
  AL022324,IGLL3  EX1             MGHGETDARVRGKGSLRPQGKRVTGKRGQSHVISSRDTRYSRRTLDMTMRRALLAMTWERW





_____________________________________________________________________________________________________________________________________________________________________________________________

      IGLL
      genes (1)
_____________________________________________________________________________________________________________________________________________________________________________________________
 
                                  1    5   10   15   20   25   30   35   40
                                  . ...|....|....|....|....|....|....|....|
  M27749  ,IGLL1  EX2            (R)FLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVL
  X52203  ,IGLL2  EX2  (2)       (R)FLLQRGSWTGARCWPWGFQSKHNSVKHVFGSGTQLTVL
  AL022324,IGLL3  EX2            (G)FLLQRGSWTGPGCWPRGFQSKHNSVKHVFGSGTQLTVL




_____________________________________________________________________________________________________________________________________________________________________________________________

      IGLL
      genes
_____________________________________________________________________________________________________________________________________________________________________________________________

                                                A        AB     B          BC         C     CD      D          DE           E      EF   F            FG          G             
                                              (1-15)          (16-26)    (27-38)    (39-45)       (77-84)                 (85-96)     (97-104)    (105-117)  (118-128)               
                                         ———————————————>   ——————————>             ——————>       ———————>              ———————————>  ———————>               ——————————>
                                         1         10  15   16  20 2326 27      36  3941 45       77 80 84              85  89    96  97   104  105      117 118     128
                                87654321 | ........|....|123|...|..|..| |........|  |.|...|1234567|..|...|12345677654321|...|......|12|......| |...........| |.........|
  M27749  ,IGLL1  EX3            (S)QPKA T PSVTLFPPSSEELQ...ANKATLVCLMN DFYP..GILT  VTWKADGTPITQ..GVEMTTPSKQSN......NKYAASSYLSLTPEQW..RSRRSYSC QVMHE....GSTV EKTVAPAECS
  X52203  ,IGLL2  EX3  (2)       (G)QPKT T PSVILFLPSCEEPQ...ANKATLVCLMN N#YP..GILM  VTWKADGTLITQ..SVEKTTPSKQSN......NKYVASSYLSLTPEQW..RSRRSYSC QVMQE....GSTV EKSVAPAECS
  AL022324,IGLL3  EX3            (G)QPKA T PSVTLFLPSSEELQ...ANKATLVCLMN DFYL..GILT  VTWKADGTPITQ..GVEMTTPSKQSN......SKYMASSYLSLTPEQW..RSRRSYSC QVMHE....GSTA EKTVAPAECS
 
Legend:
IMGT notes:
(1) The F, G and G of the FGXG motif found in J-REGIONs are shown in brown.
(2) IGLL2 is a Pseudogene, because of one nucleotide DELETION in EX3 (codon at positon 28 according to the IMGT numbering for C-DOMAIN and C-LIKE-DOMAIN) leading to a frameshift.
See also: