Here you are: IMGT Web resources > IMGT Repertoire (RPI) > 2. Proteins and alleles
______________________________________________________________________________________________________________________________________________________________________________________________

      IGLL
      genes
______________________________________________________________________________________________________________________________________________________________________________________________
  
                                  1       10        20        30        40        50        60        70
                                  ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|
  X04769  ,IGLL1  EX1             MKLRVGQTLGTIPRQCEVLLLLLLLGLVDGVHHILSPSSAERSRAVGPGASVGSNRPSLWALPG   



_____________________________________________________________________________________________________________________________________________________________________________________________

      IGLL
      genes (1)
_____________________________________________________________________________________________________________________________________________________________________________________________
 
                                  1    5   10   15   20   25   30   35   40
                                  . ...|....|....|....|....|....|....|....|
  X04769  ,IGLL1  EX2            (R)LLFQIIPRGAGPRCSPHRLPSKPQFWYVFGGGTQLTILG


_____________________________________________________________________________________________________________________________________________________________________________________________

      IGLL
      genes
_____________________________________________________________________________________________________________________________________________________________________________________________

                                                 A        AB     B          BC         C     CD      D          DE           E      EF   F            FG          G             
                                              (1-15)          (16-26)    (27-38)    (39-45)       (77-84)                 (85-96)     (97-104)    (105-117)  (118-128)               
                                         ———————————————>   ——————————>             ——————>       ———————>              ———————————>  ———————>               ——————————>
                                         1         10  15   16  20 2326 27      36  3941 45       77 80 84              85  89    96  97   104  105      117 118     128
                                87654321 | ........|....|123|...|..|..| |........|  |.|...|1234567|..|...|12345677654321|...|......|12|......| |...........| |.........|
  X04769  ,IGLL1  EX3            (G)QPKS D PLVTLFLPSLKNLQ...PTRPHVVCLVS EFYP..GTLV  VDWKVDGVPVTQ..GVETTQPSKQTN......NKYMVSSYLTLISDQW..MPHSRYSC RVTHE....GNTV EKSVSPAECS

 
Legend:
IMGT notes:
(1) The F, G and G of the FGXG motif found in J-REGIONs are shown in brown.
See also: