Here you are: IMGT Web resources > IMGT Repertoire (RPI) > 2. Proteins and alleles
_________________________________________________________________________________________________________________________________________________________________________________________________________________________

 Species    Gene       Accession   Chain
            name        number     domain
            (1)          (2)        (3)
________________________________________________________________________________________________________________________________________________________________________________________________________________________

                                                                  FR1-IMGT            CDR1-IMGT          FR2-IMGT        CDR2-IMGT                    FR3-IMGT                           CDR3-IMGT         FR4-IMGT
                                                                   (1-26)              (27-38)           (39-55)          (56-65)                     (66-104)                           (105-117)         (118-126)
                                                               A             B            BC         C            C'        C'C''        C''       D           E           F                FG                 G
                                                             (1-15)       (16-26)      (27-38)    (39-46)      (47-55)    (56-65)     (66-74)   (75-84)     (85-96)     (97-104)         (105-117)         (118-126)
                                                        —————————————>  ——————————>              ——————>      ————————>               ———————>  ————————>  ——————————>  ——————>                            ————————>
                                                        1       10   15 16    23 26 27        38 3941  46     47     55 56   AB   65 66     74 75   80 84 85  89    96 97   104 105  111          112 117 118     128
                                                        |........|....| |......|..| |....°°....| |.|....|AB.BA|.......| |....°°....| |.......| |....|...|A|...|......| |......| |.....|12345°°54321|....| |.........|
Dromel    ,Amalgam       M23561                         APVISQISKDVVASV GDSVEFNCTVE EVG......QLS VSWAKRPS.....ESDTNSVVL SMRN.....ILS LPDKRYN.V TVTEGPKTGS.AIYTFRIQNIEV SDMGPYEC QVLVSA.............TEKVTK KLSLQIKTPPVIAE
Xentro    ,CTX           U43330                         QVTI.QNPI.INVTS GQNATLYCTYI LNNQN..KNNLV IQWNIFQA.....KSQNQETVF FYQN.....GQS LSGPSYK.N RVTAAM..SP.GNATITISNMQS QDTGIYTC EVLN.................LPES SGQGKILLTVL
Homsap    ,CD4           1wio_A      1                  LPAATQGKKVVLGKK GDTVELTCTAS QKK......SIQ FHWKNS.........NQIKILG NQG......SFL TKGPSKLND RADSRRSLWDQGNFPLIIKNLKI EDSDTYIC EVEDQKE............EVQLLV FG
Homsap    ,CD4           1wio_A      3                    AFQKASSIVYKKE GEQVEFSFPLA FTVEKL.TGSGE LWWQAERA.....SSSKSWITF DLK.......NK EVSVKRVTQ DPKLQMGKK..LPLHLTLPQALP QYAGSGNL TLALE................AKTG KLHQEVNLVVMR
Homsap    ,CD8A          M27161                          SQFRVSPLDRTWNL GETVELKCQVL LSNP.....TSG CSWLFQPRGA.AASPTFLLYLS Q..........N KPKAAEGLD TQRFSGKRLG.DTFVLTLSDFRR ENEGYYFC SALSN................SIMY FSHFVPVFLP
Musmus    ,CD8A          P07725                         SGQLQLSPKKVDAEI GQEVKLTCEVL RDT......SQG CSWLFRNSSSELLQPTFIIYVS S..........S RSKLNDILD PNLFSARKEN.NKYILTLSKFST KNQGYYFC SITSN................SVMY FSPLPVFQK
Homsap    ,CD8B          P10966                         NSVLQQTPAYIKVQT NKMVMLSCEAK ISLS.....NMR IYWLRQRQAP.SSDSHHEFLAL WDS.......AK GTIHGEEVE QEKIAVFRDA.SRFILNLTSVKP EDSGIYFC MIVGS................PELT FGKGTQLSV
Musmus    ,CD8B          P05541                         SSALLQTPSSLLVQT NQTAKMSCEAK TFPK.....GTT IYWLRELQ.....DSNKNKHFE FLAS....RTST KGIKYGERV KKNMTLSFNS.TLPFLKIMDVKP EDSGFYFC AMVGS................PMVV FGTGTKLTVV
Dromel    ,FasciclinII   M77166                         ILEIYPKQEVQRKPV GKPLILTCRPT VPEPS...LVAD LQWKDNRN.....NTILPKPN. ............ .GRNQPP.M YT.ETL..PG.ESLALMITSLSV EMGGKYYC TASYA...............NTEIL EKGVTIKTYVAI
Homsap    ,MOX2          P41217                         TAQVQVVTQDEREQL YTTASLKCSLQ NAQE.....ALI VTWQKKKA.....VSPENMVTF SEN......HGV VIQPAYK.D KINITQL.GL.QNSTITFWNITL EDEGCYMC LFNTFG.............FGKISG TACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTV
Musmus    ,MOX2          O54816                         TAQVEVVTQDERKAL HTTASLRCSLK TSQE.....PLI VTWQKKKA.....VSPENMVTY SKT......HGV VIQPAYK.D RINVTEL.GL.WNSSITFWNTHI GDGGCYMC LFNTFG.............SQKVSG TACLTLYVQPIVHLHYNYFEHHLNIT
Homsap    ,MPZ           P25189                         QAIVVYTDREVHGAV GSRVTLHCSFW SSEWV..SDDIS FTWRYQPE.....GGRDAISIF HYAKG...QPYI DEVGTFK.E RIQWVGDPRW.KDGSIVIHNLDY SDNGTFTC DVKNPPD............IVGKTS QVTLYVFEKVPTRYGVVLGAVIG
Ratnor    ,MPZ           P06907                         LAIVVYTDREVYGAV GSQVTLHCSFW SSEWV..SDDIS FTWRYQPE.....GGRDAISIF HYAKG...QPYI DEVGTFK.E RIQWVGDPSW.KDGSIVIHNLDY SDNGTFTC DVKNPPD............IVGKTS QVTLYVFEKVPTRYGVVLGAVIG
Homsap    ,PIGR          P01833     1                    KSPIFGPEEVNSVE GNSVSITCYYP PTSVN...RHTR KYWCRQGA.....RGGCITLIS S..........E GYVSSKYAG RANLTNFPEN.GTFVVNIAQLSQ DDSGRYKC GLGINS..............RGLSF DVSLEVSQGPG
Homsap    ,PIGR          P01833     2                      LLNDTKVYTVDL GRTVTINCPFK TENA....QKRK SLYKQIGL.....YPVLVIDSS G..........Y VNPNYTG.R IRLDIQGTGQ.LLFSVVINQLRL SDAGQYLC QAGDDS..............NSNKK NADLQVL
Homsap    ,PIGR          P01833     3                       KPEPELVYEDL RGSVTFHCALG PEVA....NVAK FLCRQSSG.....ENCDVVVNT L........... GKRAPAFEG RILLNPQDKD.GSFSVVITGLRK EDAGRYLC GAHSDGQL..........QEGSPIQ AWQLFVNEEST
Homsap    ,PIGR          P01833     4                      IPRSPTVVKGVA GSSVAVLCPYN RKES.....KSI KYWCLWEG.....AQNGRCPLL VD........SE GWVKAQYEG RLSLLEEPGN.GTFTVILNQLTS RDAGFYWC LTNGD...............TLWRT TVEIKIIEGEPN
Homsap    ,PIGR          P01833     5                       LKVPGNVTAVL GETLKVPCHFP CKFS.....SYE KYWCKWNN.....TGC.QALPS ............ QDEGPSK.A FVNCDENSRL.VSLTLNLVTR.. ADEGWYWC GVKQG...............HFYGE TAAVYVAVEERKAAGSRDVSLA
Homsap    ,THY1          P04216                         VSRGQKVTSLTACLV DQSLRLDCRHE NTSSS..PIQYE FSLTRETK.....KHVLFGTVG ............ VPEHTYR.S RTNFTS..KY.HMKVLYLSAFTS KDEGTYTC ALHHSGH.............SPPIS SQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL
Homsap    ,VPREB1        S74019                         QPVLHQPPA.MSSAL GTTIRLTCTLR NDHDI...GVYS VYWYQQRP.....GHPPRFLLR YFSQ.....SDK SQGPQVP.P RFSGSKDVAR.NRGYLSISELQP EDEAMYYC AMGARSS...........EKEERER EWEEEMEPTAARTRVP
Homsap    ,VPREB3        AP000348                       QTVLAQLDA.LLVFP GQVAQLSCTLS PQHVT..IRDYG VSWYQQRA.....GSAPRYLLY YRSE.....EDH HRPADIP.D RFSAAKDEAH.NACVLTISPVQP EDDADYYC SVGYGFSP
Musmus    ,VPREB1        X05557                         QPMVHQPPL.ASSSL GATIRLSCTLS NDHNI...GIYS IYWYQQRP.....GHPPRFLLR YFSH.....SDK HQGPDIP.P RFSGSKDTTR.NLGYLSISELQP EDEAVYYC AVGLRSQ...........EKKRMER EWEGEKSYTDLGS
Musmus    ,VPREB2        X05563                         QPMVHQPPS.ASSSL GATIRLSCTLS NDHNI...GIYS IYWYQQRP.....GHPPRFLLR YFSH.....SDK HQGPDIP.P RFSGSKDTAR.NLGYLSISELQP EDEAVYYC AVGLRSH...........EKKRMER EWEGEKSYTDLGS



Legend:
IMGT notes:
(1) The numbering is according to the IMGT unique numbering for V-DOMAIN and V-LIKE-DOMAIN.
Accession numbers are from EMBL [1], IMGT/LIGM-DB [2], PDB [3] or SWISS-PROT [4].
Click on the accession number to get access to the database entry. For PDB, the letter added to the accession number corresponds to the chain. PDB sequences are from the section sequences details.
(2) Gene names (symbols) are according to the IMGT gene nomenclature (IG and TR genes), and MGI Mouse Genome Informatics or HUGO Human Genome Nomenclature Committee.
Full gene designations are the following:
  • CD4: Cluster of differentiation 4
  • CD8A: Cluster of differentiation 8 (alpha chain)
  • CD8B: Cluster of differentiation 8 (beta chain)
  • MOX2: Antigen identified by monoclonal antibody MRC OX-2
  • MPZ: Myelin protein zero
  • PIGR: Polymeric immunoglobulin receptor
  • THY1: Thy-1 cell surface antigen
(3) Domain name or number. If no number is indicated that means that there is only one C-DOMAIN or C-LIKE-DOMAIN in the chain.
See also: