IMGT Repertoire (IG and TR)
Page not found
404
The page asked does not exist.
Click here to return to homepage.
Page not found
404
The page asked does not exist.
Click here to return to homepage.

Dots indicate gaps according to the IMGT unique numbering. Blanks at the 5' and/or 3' end indicate partial sequences.

Only functional, ORF and in-frame pseudogenes are shown.

Functionality is shown between:
- parentheses, (F) and (P), when the accession number refers to rearranged genomic DNA or cDNA and the corresponding germline gene has not yet been isolated.
- brackets, [F] and [P], when the accession number refers to genomic DNA, but not known as being germline or rearranged.

N (Asn, asparagine) of potential N-glycosylation sites (NXS/T, where X is different from P), (N-linked glycosylation) is shown is green (site is underlined in CHS and in pages edited before 14/10/2009).





                    A        AB     B           BC         C     CD      D          DE           E      EF   F          FG            G              CHS


                 (1-15)          (16-26)     (27-38)    (39-45)       (77-84)                 (85-96)     (97-104)   (105-117)    (118-128)   



             ——————————————>   ——————————> ———————————> ——————>       ———————>              ———————————>  ———————> ————————————> ——————————>  


C GenesAccNum
             1        10  15   16  20 2326 27        38 3941 45       77 80 84              85  89    96  97   104 105       117 118121     130       140      150


     87654321|........|....|123|...|..|..| |..........| |.|...|1234567|..|...|12345677654321|...|......|12|......| |...........| |..|........|.........|.........|



EX1


TRAC*01Btau3.1_Chr10.30 F 
      (X)VKDPNPTVYQLRSPQ........SSDTSVCLFT DFDS.....NQV NMEKIMG.......SEGSTVHKTNSTVLN.MEILGSKSNGIVTWGN......TSDAGC EYTFNE.TIPFAS SL







               [EX2]                             [EX3]


TRAC*01Btau3.1_Chr10.30 F 
             (E)ISCNAKLVEKSFET (D)INLNSQNLSVIVFRILLLKVVGFNLLMTLRLWSS





                CONNECTING_REGION            |  TRANSMEMBRANE-REGION   |  CYTOPLASMIC-REGION




Other notes:
Bovine (Bos taurus) germline sequences were extracted from The Bovine Genome Database, Assembly 3.1 (Btau3.1), based on [1].
The localization of the sequences in the Btau3.1 project is indicated in the accession number after the underscore.

Sequences were annotated and entered in IMGT/LIGM-DB and flat files were generated by IMGT®.


IMGT references:
[1]:  Herzig, C.T. et al., BMC Genomics, 11, 100-100 (2010). PMID:20144200.