IMGT Repertoire (IG and TR)

Only the *01 allele of each functional, ORF and in-frame pseudogenes C-REGION is shown.

Letters in red correspond to amino acids which are polymorphic in the other alleles.
For C-REGIONs, letters in bold correspond to additional positions in the IMGT unique numbering.
For C-REGIONs, letters between parentheses correspond to amino acids resulting from the splicing.

Dots indicate gaps according to the IMGT unique numbering. Blanks at the 5' and/or 3' end indicate partial sequences.

Only functional, ORF and in-frame pseudogenes are shown.

Functionality is shown between:
- parentheses, (F) and (P), when the accession number refers to rearranged genomic DNA or cDNA and the corresponding germline gene has not yet been isolated.
- brackets, [F] and [P], when the accession number refers to genomic DNA, but not known as being germline or rearranged.

N (Asn, asparagine) of potential N-glycosylation sites (NXS/T, where X is different from P), (N-linked glycosylation) is shown is green (site is underlined in CHS and in pages edited before 14/10/2009).

                    A        AB     B           BC         C     CD      D          DE           E      EF   F          FG            G              CHS
                 (1-15)          (16-26)     (27-38)    (39-45)       (77-84)                 (85-96)     (97-104)   (105-117)    (118-128)   
             ——————————————>   ——————————> ———————————> ——————>       ———————>              ———————————>  ———————> ————————————> ——————————>  
C GenesAccNum
             1        10  15   16  20 2326 27        38 3941 45       77 80 84              85  89    96  97   104 105       117 118121     130       140      150
     87654321|........|....|123|...|..|..| |..........| |.|...|1234567|..|...|12345677654321|...|......|12|......| |...........| |..|........|.........|.........|
EX1
TRDC*01Btau3.1_Chr10.30 F
     (X)SQPAASPSVFVMKNG...........TNVACLVK EFYP....KDVT ISLQSSKKI.....IEYDPAIAISPG.......GKYSAVKLGQYGD......PDSVTC SVEHNK.QTWHST DFEPKKTIP
               [EX2]                             [EX3]
TRDC*01Btau3.1_Chr10.30 F
   (E)TTPKPMAYENSTKAEAPVTCQEPQ (V)QPGKVNMMSLSVLGLRMLFAKSVAVNFLLTAKLFFF
                CONNECTING_REGION            |  TRANSMEMBRANE-REGION   |  CYTOPLASMIC-REGION

Other notes:
Bovine (Bos taurus) germline sequences were extracted from The Bovine Genome Database, Assembly 3.1 (Btau3.1), based on [1]. The localization of the sequences in the Btau3.1 project is indicated in the accession number after the underscore.
Sequences were annotated and entered in IMGT/LIGM-DB and flat files were generated by IMGT®.

IMGT references:
[1] Herzig, C.T. et al., BMC Genomics, 11, 100-100 (2010). PMID:20144200.