Protein display: Turbot (Scophthalmus maximus) IGH V-REGIONs

Only the *01 allele of each functional, ORF and in-frame pseudogene V-REGION is shown.

Dots indicate gaps according to the IMGT unique numbering. Blanks at the 5' and/or 3' end indicate partial sequences.

____________________________________________________________________________________________________________________________________________________

       IGHV                          FR1-IMGT           CDR1-IMGT       FR2-IMGT      CDR2-IMGT                 FR3-IMGT                  CDR3-IMGT
       gene                           (1-26)             (27-38)        (39-55)        (56-65)                  (66-104)                  (105-115)
___________________________ __________________________ ____________ _________________ __________ _______________________________________ ___________
                            1       10        20         30         40        50         60         70        80        90        100        110
                            .........|.........|...... ...|........ .|.........|..... ....|..... ....|.........|.........|.........|.... .....|.....

#c AJ296096,IGHV1S1                                                           GMHWIGM RSTGVS.... YYKDSLK.NKFSIDLDTCSKTVTLNGQNVQPEDTAVYYC AK.........
#c Rearranged cDNA

Created: 15/11/2001
Author: Nathalie Bosc