The TRA protein display numbering is according to the IMGT unique numbering for C-DOMAIN and C-LIKE-DOMAIN.
Letters in red correspond to amino acids which are polymorphic in the other alleles.
For C-REGIONs, letters in bold correspond to additional positions in the IMGT unique numbering.
For C-REGIONs, letters between parentheses correspond to amino acids resulting from the splicing.
N (Asn, asparagine) of potential N-glycosylation sites (NXS/T, where X is different from P), (N-linked glycosylation) is shown is green (site is underlined in CHS and in pages edited before 14/10/2009).
_____________________________________________________________________________________________________________________________________________________________________________________________ TRA C-GENEs ____________________________________________________________________________________________________________________________________________________________________________________________ A AB B BC C CD D DE E EF F FG G --------------> ----------> ------> -------> -----------> -------> ------------> 1 10 15 16 20 23 26 30 36 39 41 45 77 84 85 89 96 97 104 110 118 121 130 87654321|........|....|123|...|...... ...|.....| |.....|1234567|......|12345677654321|..........|12|....... .....|....... ..|.........| EX1 AF110525,TRAC (G)DQYQPSFYKLK.........HGNTSACLAT GFSR..FHQL QNNTLFS.......QSKAVLISQDS........LFNQVAFMDQDA.......DGETSC ...........PE EX2 AF110525,TRAC (D)ENEGAVRCDDALQP EX3 AF110525,TRAC (D)PLVNLVSLMVTGLRVLLLKTMIFNILMTLRLRISQ CONNECTING-REGION TRANSMEMBRANE-REGION CYTOPLASMIC-REGION
Created: 30/06/2003
Author: Nathalie Bosc