Introduction
IMGT/DomainGapAlign is part of IMGT®,
the international ImMunoGeneTics information system®, the high-quality integrated information system
specialized in immunoglobulins (IG), T cell receptors (TR), major histocompatibility complex (MH) of human
and other vertebrates species, immunoglobulin superfamily (IgSF), MH superfamily (MhSF) and related proteins
of the immune system (RPI), created in 1989 by Marie-Paule Lefranc (Laboratoire
d'ImmunoGénétique Moléculaire, LIGM, Université Montpellier II and CNRS) and on
the Web since July 1995.
IMGT/DomainGapAlign is a tool which analyses amino acid sequences per domain.
IMGT/DomainGapAlign Query page
What IMGT/DomainGapAlign allows?
- To create gaps in your amino acid sequence, according to the IMGT unique numbering, for:
- the V-REGION or C-DOMAIN of the IG or TR,
- the V-LIKE-DOMAIN and C-LIKE-DOMAIN of the other IgSF,
- the G-DOMAIN and C-LIKE-DOMAIN of the MH,
- the G-LIKE-DOMAIN and C-LIKE-DOMAIN of the other MhSF.
- To align your own amino acid sequence with the
IMGT domain directory and to identify:
- the closest germline IMGT genes and alleles for the V-REGION and J-REGION of the IG or TR,
- the closest IMGT genes and alleles for the C-DOMAIN of the IG or TR,
- the closest IMGT gene and allele for the C-LIKE-DOMAIN of the other IgSF,
- the closest IMGT gene and allele for the G-DOMAIN and C-LIKE-DOMAIN of the MH,
- the closest IMGT gene and allele for the G-LIKE-DOMAIN and C-LIKE-DOMAIN of the other MhSF.
- To delimit the strands and loops of:
- the V domains (V-DOMAIN and V-LIKE-DOMAIN),
- the C domains (C-DOMAIN and C-LIKE-DOMAIN),
- the G domains (G-DOMAIN and G-LIKE-DOMAIN) platforms,
- and to delimit the helix of the G domains (G-DOMAIN and G-LIKE-DOMAIN).
- To draw the IMGT Collier de Perles of your V-REGION (V-DOMAIN, see below)
or C-DOMAIN by clicking on the name (in green) of your sequence in the alignment.
IMGT/DomainGapAlign Query
Paste or upload your file containing domain sequences in FASTA format.
Several sequences can be analysed simultaneously and users can choose how many alignments to display for
each sequence. Here are examples of sequences in the required format (variable domain):
>AE000658|TRAV4*01|Homo sapiens|F|V-REGION
LAKTTQPISMDSYEGQEVNITCSHNNIATNDYITWYQQFPSQGPRFIIQGYKTKVTNEVA
SLFIPADRKSSTLSLPRVSLSDTAVYYCLVGD
Or
>12e8_P|2E8|Mus musculus||VH-CH1
EVQLQQSGAEVVRSGASVKLSCTASGFNIKDYYIHWVKQRPEKGLEWIGWIDPEIGDTEY
VPKFQGKATMTADTSSNTAYLQLSSLTSEDTAVYYCNAGHDYDRGRFPYWGQGTLVTVSA
AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSD
LYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Select
'V' for sequences of the variable domains of heavy and light chains. Select
'C' for sequences of the constant domains of heavy and light chains. To delimit the domains (CH1, CH2, CH3) of the heavy chains, an easy way is to check with
IMGT Alignments of alleles (in IMGT Repertoire).
In IMGT, the 'domain type' concept has three main concepts: the V type (V for variable), the C type (C for constant) and the G type (G for groove).
'V type' identifies the domain type of domains described as V-DOMAIN and V-LIKE-DOMAIN.
'C type' identifies the domain type of domains described as C-DOMAIN and C-LIKE-DOMAIN.
'G type' identifies the domain type of domains described as G-DOMAIN and G-LIKE-DOMAIN.
Select the species in the drop-down list.
Select the minimum or maximum Smith-Waterman score for the alignments to display (For example, choosing a "Smith-Waterman score above 200" will provide and display alignments whose Smith-Waterman score is superior to 200).
Select the number of alignments to display (Displayed alignments) and tick off the checkbox if you want to display IMGT Colliers de Perles.
| V: V-ALPHA, V-BETA, V-DELTA, V-GAMMA, V-KAPPA, V-LAMBDA, V-LIKE. |
| G: G-ALPHA, G-ALPHA1, G-ALPHA1-LIKE, G-ALPHA2, G-ALPHA2-LIKE, G-BETA. |
| C: C-ALPHA, C-BETA-1, C-BETA-2, C-DELTA, C-GAMMA-1, C-GAMMA-2, C-GAMMA-3,
C-GAMMA-4, C-GAMMA-5, C-GAMMA-6, C-KAPPA, C-LAMBDA, C-LIKE. |
IMGT/DomainGapAlign and IMGT/Collier-de-Perles results for V-domain
IMGT/DomainGapAlign gene and allele identification
IMGT/DomainGapAlign identifies the closest germline V-REGION (for 'V') and the closest C-DOMAIN (for 'C').The IMGT gene and allele
name of the closest sequence(s) from the IMGT reference directory is (are) provided with a percentage of identity.
IMGT nomenclature is based on the CLASSIFICATION axiom and concepts of IMGT-ONTOLOGY [1]. IMGT gene and allele names were approved by the HUGO Nomenclature Committee (HGNC) and by WHO-IUIS Nomenclature Committee [2]. They are used by Entrez Gene (NCBI), GDB, GeneCards, Ensembl (EBI)...
IMGT/DomainGapAlign Alignment display
IMGT/DomainGapAlign displays your amino acid sequences with IMGT gaps and, for 'V', with delimitations of the FR-IMGT and CDR-IMGT, according to the IMGT unique numbering for V-REGION and V-DOMAIN [3], and for 'C', with delimitation of the strand and loops, according to the IMGT unique numbering for C-DOMAIN [4]. Amino acids in bold represent differences between the closest germline V-REGION (for 'V') or C-DOMAIN (for 'C) and the sequences submitted by users.
IMGT/DomainGapAlign identification and download
IMGT/DomainGapAlign displays your amino acid sequences with IMGT color menu for domains and regions, according to the IMGT Scientific chart. You can display or download your amino acid sequences with or without gaps.
IMGT/DomainGapAlign results summary
A summary of the results is provided as a table and contains following informations:
- Sequence name
- REGION (V-REGION) identity percentage
- CDR-IMGT lengths
- Number of different amino acids in CDR1- and CDR2-IMGT
- FR-IMGT lengths
- Number of different amino acids in FR-IMGT
- Total number of amino acids changes in domain
The AA changes are shown in strands and loops and in FR- and CDR-IMGT.
IMGT/DomainGapAlign and IMGT Collier de Perles
IMGT Collier de Perles, on one and two layers, with amino acids changes are generated (complete Collier de Perles, comprising CDR3-IMGT and FR4-IMGT).
- IMGT Colliers de Perles on one layer

- IMGT Colliers de Perles on two layers

IMGT/Collier-de-Perles tool
The IMGT/Collier-de-Perles tool allows you to choose the CDR-IMGT color type, the Background color, the Amino acid insertions, the CDR3-IMGT lenght and the domain title:
1) CDR-IMGT color type
- For (IGK,IGL,TRA,TRG), CDR-IMGT regions are colored as follows: CDR1-IMGT (blue), CDR2-IMGT (green) and CDR3-IMGT (greenblue).
- For (RPI,IGH,TRB,TRD), CDR-IMGT regions are colored as follows: CDR1-IMGT (red), CDR2-IMGT (orange) and CDR3-IMGT (purple).
2) Background color
3) Domain sequence
4) In "Your domain title" box (optional), type a clone name (that you would like to be displayed in the figure).
For normal IG and TR domains, you do not need to use the "Amino acid insertions" boxes. These boxes allow to deal with IgSF V-LIKE-DOMAIN and C-LIKE-DOMAIN which have amino acid insertions compared to the IG and TR domains.
IMGT/DomainGapAlign and IMGT/Collier-de-Perles results for C-domain
>SEQ_C_DOM
TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLRSPVTKSFNRGEC
IMGT/DomainGapAlign gene and allele identification
IMGT/DomainGapAlign Alignment display
IMGT/DomainGapAlign identification and download
IMGT/DomainGapAlign results summary
A summary of the results is provided as a table and contains following informations:
- Sequence name
- REGION (C-REGION) identity percentage
- Total number of amino acids changes in domain
- Amino acids changes by Strands, Turns and loops
IMGT/DomainGapAlign and IMGT Collier de Perles
IMGT Collier de Perles, on one and two layers, with amino acids changes are generated (complete Collier de Perles).
- IMGT Colliers de Perles on one layer

- IMGT Colliers de Perles on two layers

IMGT/DomainGapAlign and IMGT/Collier-de-Perles results for G-domain
>pMH75
FRPWFLEYCKSECHFYNTTQRVRLLVRYFYNLELNLRFDSDVGEFRAVTELGQPDAENWNSQPEFLEQKRAEVDTVCRHNYEIFDNFLVPRR
IMGT/DomainGapAlign gene and allele identification
IMGT/DomainGapAlign Alignment display
IMGT/DomainGapAlign identification and download
4.4 IMGT/DomainGapAlign results summary
A summary of the results is provided as a table and contains following informations:
- Sequence name
- REGION (G-REGION) identity percentage
- Total number of amino acids changes in domain
- Amino acids changes by Strands, Turns and loops
IMGT/DomainGapAlign and IMGT Collier de Perles
IMGT Collier de Perles, on one and two layers, with amino acids changes are generated.
- IMGT Colliers de Perles on one layer

- IMGT Colliers de Perles on one layer (with AA changes)

IMGT/Collier-de-Perles tool for G-DOMAIN
First select Domain type: Groove(G)
1. IMGT/DomainGapAlign steps
Before using IMGT/Colliers-de-Perles for G-domain, align your sequences against the human ones using IMGT/DomainGapAlign
to be sure to localize the gaps at the right positions (including the gaps at the beginning of the sequences).
Model for MH class I gaps
>HLA-A*0102 G-ALPHA1
..........GSHSMRY.FSTSVSRPGSGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRA.......PWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSED..
>HLA-A*0102 G-ALPHA2
..........GSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNED..LRSWTAAD.......MAAQITKRKWEAV.HAAEQRRVYLEGRCVDGLRRYLENGKETLQRT
Model for MH class II gaps
>HLA-DRA*0101 G-ALPHA
........IKEEHVIIQ.AEFYLNP....DQSGEFMFDFDGDEIFHVDMA..KKETVWRL.......EEFGR....FASFEAQGALANIAVDKANLEIMTKRSNYTPITN...
>HLA-DRB1*0101 G-BETA
......GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSD..VGEYRAVT.......ELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRR........
Note that IMGT/DomainGapAlign provide more sequences, but be aware that in these alignments the numbering includes
gaps for MH1, MH2 and RPI-MH1Like like comparison.
2. IMGT/Collier-de-Perles steps
In Make Your Own IMGT Collier de Perles page (IMGT/Collier-de-Perles), select Domain type: Groove(G).
For MH1, click 'Link G-DOMAINs'.
Paste in the 'Domain 1 sequence' window the sequence of G-ALPHA1 (for MH1) or G-ALPHA (for MH2).
Paste in the 'Domain 2 sequence' window the sequence of G-ALPHA2 (for MH1) or G-BETA (for MH2).
The IMGT "Colliers de Perles" obtained are respectively as follow:
IMGT/DomainGapAlign and IMGT/Collier-de-Perles results for S-domain
>SEQ_S_DOM
PAVESRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQD
IMGT/DomainGapAlign gene and allele identification
IMGT/DomainGapAlign Alignment display
IMGT/DomainGapAlign identification and download
IMGT/DomainGapAlign results summary
A summary of the results is provided as a table and contains following informations:
- Sequence name
- REGION (S-REGION) identity percentage
- Total number of amino acids changes in domain
- Amino acids changes by Strands, Turns and loops
IMGT/DomainGapAlign and IMGT Collier de Perles
IMGT Collier de Perles, on one and two layers, with amino acids changes are generated (complete Collier de Perles).
- IMGT Colliers de Perles on one layer

- IMGT Colliers de Perles on two layers

References
| [1] |
Lefranc, M.-P. , Giudicelli, V., Ginestoux, C., Bosc, N., Folch, G., Guiraudou, D., Jabado-Michaloud, J., Magris, S., Scaviner, D., Thouvenin, V., Combres, K., Girod, D., Jeanjean, S., Protat, C., Yousfi-Monod, M., Duprat, E., Kaas, Q., Pommie, C., Chaume, D. and Lefranc G.,
IMGT-ONTOLOGY for immunogenetics and immunoinformatics,
In Silico Biology 4:17-29 (2004).
|
| [2] |
Lefranc, M.-P.,
WHO-IUIS Nomenclature Subcommittee for Immunoglobulins and T cell receptors report,
Dev. Comp. Immunol. (in press).
|
| [3] |
Lefranc, M.-P., Pommié, C., Ruiz, M., Giudicelli, V., Foulquier, E., Truong, L., Thouvenin-Contet, V. and Lefranc G.,
IMGT unique numbering for immunoglobulin and T cell receptor variable domains and Ig superfamily V-like domains,
Dev Comp Immunol 27:55-77 (2003).
PMID:12477501.
|
| [4] |
Lefranc, M.-P., Pommié, C., Kaas, Q., Duprat, E., Bosc, N., Guiraudou, D., Jean, C., Ruiz, M., Da Piedade, L., Rouard, M., Foulquier, E., Thouvenin, V. and Lefranc G.,
IMGT unique numbering for immunoglobulin and T cell receptor constant domains and Ig superfamily C-like domains,
Dev Comp Immunol 29:185-203 (2005).
PMID:15572068.
|
Version
- 4.11.0 (2026-07-22)
-
- Improve gaps for domains V and C so that they are more consistent with the IMGT unique numbering (see '2. Numbering' at IMGT Scientific chart).
- 4.10.4 (2025-12-12)
-
- Remove an issue when V-DOMAIN contains stop codon (mainly when present in CDR3-IMGT or FR4-IMGT).
- 4.10.3 (2021-12-06)
-
- Solve problem of V-DOMAIN with CDR3-IMGT more than 31 AA length: the 'CDR_lengths' value is more consistent now.
- 4.10.2 (2021-01-26)
-
- Take into account the 'Smith-Waterman score above' parameter
- 4.10.1 (2021-01-22)
-
- 4.10.0 (2019-05-06)
-
- Revised interface (HTML/CSS/Javascript)
- Improve alignment rendering
- Reduce inconsistency with the corresponding 'Results summary'
- Improved link to IMGT/Collier-de-Perles when there are insertions
- 4.9.2 (2016-09-26)
-
- 4.9.1 (2013-12-19)
-
- Update linking to IMGT/GENE-DB
- Javascript fixes (species selection)
- Internal changes
- 4.9.0 (2013-04-06)
-
- Handle both mixed-case (upper/lower) input sequence
- For V-DOMAIN, show V and J reference allele alignment separetely
- More internal changes
- Created:
- 10/12/06
- IMGT/DomainGapAlign development:
- IMGT/DomainGapAlign was implemented by Quentin Kaas (2005) and has been developed
since 2006 by François Ehrenmann,
and since 2011 by Patrice Duroux