database logo
Citing IMGT/DomainGapAlign:
Ehrenmann F., Kaas Q., Lefranc M.-P., Nucleic Acids Res., 38(S1):D301-D307 (2010). DOI:10.1093/nar/gkp946. PMID:19900967. pdf LIGM:361
Ehrenmann F., Lefranc M.-P., Cold Spring Harb Protoc., 2011(6):737-749 (2011). DOI:10.1101/pdb.prot5636. PMID:21632775.
IMGT booklet pdficon (high resolution) pdficon (low resolution) (with generous provision from Cold Spring Harbor (CSH) Protocols).

Introduction

IMGT/DomainGapAlign Query page

IMGT/DomainGapAlign and IMGT/Collier-de-Perles results for V-domain

IMGT/DomainGapAlign and IMGT/Collier-de-Perles results for C-domain

>SEQ_C_DOM TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLRSPVTKSFNRGEC

IMGT/DomainGapAlign and IMGT/Collier-de-Perles results for G-domain

>pMH75 FRPWFLEYCKSECHFYNTTQRVRLLVRYFYNLELNLRFDSDVGEFRAVTELGQPDAENWNSQPEFLEQKRAEVDTVCRHNYEIFDNFLVPRR

IMGT/DomainGapAlign and IMGT/Collier-de-Perles results for S-domain

>SEQ_S_DOM PAVESRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQD

References

[1] Lefranc, M.-P. , Giudicelli, V., Ginestoux, C., Bosc, N., Folch, G., Guiraudou, D., Jabado-Michaloud, J., Magris, S., Scaviner, D., Thouvenin, V., Combres, K., Girod, D., Jeanjean, S., Protat, C., Yousfi-Monod, M., Duprat, E., Kaas, Q., Pommie, C., Chaume, D. and Lefranc G., IMGT-ONTOLOGY for immunogenetics and immunoinformatics, In Silico Biology 4:17-29 (2004).
[2] Lefranc, M.-P., WHO-IUIS Nomenclature Subcommittee for Immunoglobulins and T cell receptors report, Dev. Comp. Immunol. (in press).
[3] Lefranc, M.-P., Pommié, C., Ruiz, M., Giudicelli, V., Foulquier, E., Truong, L., Thouvenin-Contet, V. and Lefranc G., IMGT unique numbering for immunoglobulin and T cell receptor variable domains and Ig superfamily V-like domains, Dev Comp Immunol 27:55-77 (2003). PMID:12477501.
[4] Lefranc, M.-P., Pommié, C., Kaas, Q., Duprat, E., Bosc, N., Guiraudou, D., Jean, C., Ruiz, M., Da Piedade, L., Rouard, M., Foulquier, E., Thouvenin, V. and Lefranc G., IMGT unique numbering for immunoglobulin and T cell receptor constant domains and Ig superfamily C-like domains, Dev Comp Immunol 29:185-203 (2005). PMID:15572068.

Version

4.11.0 (2026-07-22)
  • Improve gaps for domains V and C so that they are more consistent with the IMGT unique numbering (see '2. Numbering' at IMGT Scientific chart).
4.10.4 (2025-12-12)
  • Remove an issue when V-DOMAIN contains stop codon (mainly when present in CDR3-IMGT or FR4-IMGT).
4.10.3 (2021-12-06)
  • Solve problem of V-DOMAIN with CDR3-IMGT more than 31 AA length: the 'CDR_lengths' value is more consistent now.
4.10.2 (2021-01-26)
  • Take into account the 'Smith-Waterman score above' parameter
4.10.1 (2021-01-22)
  • Minor maintenance
4.10.0 (2019-05-06)
  • Revised interface (HTML/CSS/Javascript)
  • Improve alignment rendering
  • Reduce inconsistency with the corresponding 'Results summary'
  • Improved link to IMGT/Collier-de-Perles when there are insertions
4.9.2 (2016-09-26)
  • Handle A and F domains
4.9.1 (2013-12-19)
  • Update linking to IMGT/GENE-DB
  • Javascript fixes (species selection)
  • Internal changes
4.9.0 (2013-04-06)
  • Handle both mixed-case (upper/lower) input sequence
  • For V-DOMAIN, show V and J reference allele alignment separetely
  • More internal changes
Created:
10/12/06
IMGT/DomainGapAlign development:
IMGT/DomainGapAlign was implemented by Quentin Kaas (2005) and has been developed since 2006 by François Ehrenmann, and since 2011 by Patrice Duroux
Contact: Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr
Editors: Quentin Kaas (2001-2007), François Ehrenmann (2006-2011), Caroline Tournier (2011-2013), Typhaine Paysan-Lafosse (2013-2016), Anjana Kushwaha (2017) and Patrice Duroux